Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 100207 |
Name | oriT_pAD1 |
Organism | Enterococcus faecalis |
Sequence Completeness | incomplete |
NCBI accession of oriT (coordinates [strand]) | AH011360 ( , 13 nt) |
oriT length | 13 nt |
IRs (inverted repeats) | _ |
Location of nic site | 6..7 |
Conserved sequence flanking the nic site |
_ |
Note | CloDF13 familiy |
oriT sequence
Download Length: 13 nt
GAAAATGGTCAGG
Visualization of oriT structure (The oriT was characterized experimentally)
oriT secondary structure
Predicted by RNAfold.
Download structure fileReference
[1] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
[2] Francia MV et al. (2002) Transfer origins in the conjugative Enterococcus faecalis plasmids pAD1 and pAM373: identification of the pAD1 nic site, a specific relaxase and a possible TraG-like protein. Mol Microbiol. 45(2):375-95. [PMID:12123451]
[3] Francia MV et al. (2001) Completion of the nucleotide sequence of the Enterococcus faecalis conjugative virulence plasmid pAD1 and identification of a second transfer origin. Plasmid. 46(2):117-27. [PMID:11591137]
Relaxase
ID | 200 | GenBank | AAL59457 |
Name | Orf57_pAD1 | UniProt ID | Q8VT37 |
Length | 216 a.a. | PDB ID | |
Note | Replication-relaxation; pfam13814 |
Relaxase protein sequence
Download Length: 216 a.a. Molecular weight: 26040.98 Da Isoelectric Point: 8.3546
MAKKSSVYGNLKKLKEKNLVECSQIGSTKFYYLTKEGHNYIGGYYTLPKVPEYNLQHHLQINDYLIKMLE
LCNNHPHLKAVVSERRKVYEVKDEKKNQKGVKYFVPDFIFMFLDSIGREVEWQFEIELTLKTKRRYSQGV
FPKYIKHLKNYEDARLIYVTPSSIIKEELDMFKEYFIDKEGDEYKEVFDRLHVFSAEEFESELKRLLEKD
KFINWE
Protein domains
No domain identified.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q8VT37 |
Reference
[1] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
[2] Francia MV et al. (2002) Transfer origins in the conjugative Enterococcus faecalis plasmids pAD1 and pAM373: identification of the pAD1 nic site, a specific relaxase and a possible TraG-like protein. Mol Microbiol. 45(2):375-95. [PMID:12123451]
[3] Francia MV et al. (2001) Completion of the nucleotide sequence of the Enterococcus faecalis conjugative virulence plasmid pAD1 and identification of a second transfer origin. Plasmid. 46(2):117-27. [PMID:11591137]
T4CP
ID | 200 | GenBank | AAL59453 |
Name | Orf53_pAD1 | UniProt ID | Q8VT41 |
Length | 747 a.a. | PDB ID | _ |
Note | conjugative coupling factor TraD, SXT/TOL subfamily; TIGR03743 |
T4CP protein sequence
Download Length: 747 a.a. Molecular weight: 85562.94 Da Isoelectric Point: 6.3682
MFNNGLLQPKKPPIGQEQQKMTRYHQLRLVFGLVGVLLYPFAILGSIPLLIGLAVDKRDKAANVFDMDYE
SFLKRNSIVFLSFSAVLFVINAFAFILWIPRGYLSAYLLFPLNLLHTALRFNWETIVALLIGSSGMGAIF
LAFSSFVAKRKVISKEDERKKITESKAYKDREKNKFKESQRFTDEQEEAYEEAVETVDIDKYKELSNQLL
LGTSEFGLPYIINFSEFNQHVLVPATTGSGKTTLLQLLVQHAVKFNFPVILIDGKGARDTLESMREIAKF
YDKEVHAFTDDGDMRYNPVEHGNDISIRDKLVSLAETESVFYSGAAKALLQVTIQLLDEFKGAKVTLSGD
TRTTETVERSLPFVQRFLLPRNVLHLFADAILQNNPKLFEIEVEKKIQQPKKKSAKERSEILPDSDLDKE
EKEEDSQIRNSKFRNISQLGIAQKETETVVLNPETLDLDSYYLLLKRNLRYLPTDKETGENIKQKLFERL
FVRYEHKDSPFYLYATSEALQTNINMLLDSELGKLFDTKNAKNVLDVQEIVNQRKLVYVSFNGLIYKEYI
RTLAQMLVGDVNYFASEMYRKNVKREVLVIFDEPASYLNETFIDMVNKGRGAGVYGIFTPQTMADIAKLG
DKLMEQLVGNVNTLFIGKTNEKGEAEYWSETMGTYQDIDVTSVTEQEDGYSDVGKSDWSGDRGTKRNVDR
FKISPNKIKELRTGEFIIYRTAENVNLPPQKVYVRNALEWLQKSNSK
Protein domains
Predicted by InterproScan.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q8VT41 |
Reference
[1] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
[2] Francia MV et al. (2002) Transfer origins in the conjugative Enterococcus faecalis plasmids pAD1 and pAM373: identification of the pAD1 nic site, a specific relaxase and a possible TraG-like protein. Mol Microbiol. 45(2):375-95. [PMID:12123451]
Host bacterium
ID | 200 | GenBank | AH011360 |
Plasmid name | pAD1 | Incompatibility group | - |
Plasmid size | 23020 bp | Coordinate of oriT [Strand] | _ |
Host baterium | Enterococcus faecalis |
Cargo genes
Drug resistance gene | _ |
Virulence gene | cylR2, cylR1 |
Metal resistance gene | _ |
Degradation gene | _ |
Symbiosis gene | - |
Anti-CRISPR | AcrIIA9 |