Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100206 |
| Name | oriT_CloDF13 |
| Organism | Escherichia coli |
| Sequence Completeness | incomplete |
| NCBI accession of oriT (coordinates [strand]) | NC_002119 (9750..9762 [+], 13 nt) |
| oriT length | 13 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | 7..8 |
| Conserved sequence flanking the nic site |
_ |
| Note | CloDF13 familiy |
oriT sequence
Download Length: 13 nt
GTGGGTGGTCGGG
Visualization of oriT structure (The oriT was characterized experimentally)
oriT secondary structure
Predicted by RNAfold.
Download structure file
Reference
[1] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
[2] Núñez B et al. (2001) Two atypical mobilization proteins are involved inplasmid CloDF13 relaxation. Mol Microbiol. 39(4):1088-99. [PMID:11251827]
Relaxase
| ID | 199 | GenBank | NP_052376 |
| Name | MobC_CloDF13 |
UniProt ID | P08097 |
| Length | 148 a.a. | PDB ID | |
| Note | relaxase | ||
Relaxase protein sequence
Download Length: 148 a.a. Molecular weight: 15933.34 Da Isoelectric Point: 10.5193
MILRGCTMALERYNVSQPKRQAERGENTADPALAAGRACSTAELVARRLGIAAVQPVYRFLDTWWRKGCW
SGEITRLTAVRSACGADAARGGVLVRRGRAADGHYSVSCRRGVCAQLPRTGWPFELLRLAMEGNSRGAPA
GGTCTVLP
Protein domains
No domain identified.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | P08097 |
Reference
[1] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
[2] Núñez B et al. (2001) Two atypical mobilization proteins are involved inplasmid CloDF13 relaxation. Mol Microbiol. 39(4):1088-99. [PMID:11251827]
T4CP
| ID | 199 | GenBank | NP_052377 |
| Name | MobB_CloDF13 |
UniProt ID | P08098 |
| Length | 529 a.a. | PDB ID | _ |
| Note | Type IV Secretion System Coupling Protein | ||
T4CP protein sequence
Download Length: 529 a.a. Molecular weight: 57840.66 Da Isoelectric Point: 11.1068
MGLSHKERREYGRSYKRDNNRTAPFSCWPRWIRPGGWSGHGGMSGTTRTGVTARLAFWGGWLSPCLSRAG
EKPSCVRTSTRTQIITCCSRLTCSGLPGARAGWLSGLCWRGSGVLLLDGHFAAADEAVNRKLNRRAGAQP
ATGEMTDVRQPAFRGAGTVNALARFFHGRGPETAGVFLGKDEQGEPVLVPRDTWRKTNIQILGLPGSGKS
VMATNALIRSVRDFGDAVVYFDQRGPVAALLPAHCPNFTLLDLRPGKPAQLNLFRDLDQYALKNLLVAGF
NLSETGHVADHYRISEQKAAKLIAEQVSAGGKHSAGAGGGVRAAGGPEKGREGADHQAGERGRPERPADG
QRHRRGGDNQRRRLLYVIGSMDDEAVIRVQKMLFARCAQIIIARDEFRRWPHASIMLDEIKYLLSKYVLN
ALGTVRSRDCNLRLAHHAGRLRAAGQDLPADFVKTTVLDNTPIRWFYRAASQESRSGAGQTGEIRVDVER
RGPAGRRGTWSISAGTASSRRSRPLFDVNTLQHLLTGSR
Protein domains
No domain identified.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | P08098 |
Reference
[1] Buscher BA et al. (2005) The DotL protein, a member of the TraG-coupling protein family, is essential for Viability of Legionella pneumophila strain Lp02. J Bacteriol. 187(9):2927-38. [PMID:15838018]
[2] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
[3] Núñez B et al. (2001) Two atypical mobilization proteins are involved inplasmid CloDF13 relaxation. Mol Microbiol. 39(4):1088-99. [PMID:11251827]
[4] Cabezón E et al. (1994) Requirements for mobilization of plasmids RSF1010 and ColE1 by the IncW plasmid R388: trwB and RP4 traG are interchangeable. J Bacteriol. 176(14):4455-8. [PMID:8021231]
Host bacterium
| ID | 199 | GenBank | NC_002119 |
| Plasmid name | CloDF13 | Incompatibility group | ColRNAI |
| Plasmid size | 9957 bp | Coordinate of oriT [Strand] | 9750..9762 [+] |
| Host baterium | Escherichia coli |
Cargo genes
| Drug resistance gene | _ |
| Virulence gene | _ |
| Metal resistance gene | _ |
| Degradation gene | _ |
| Symbiosis gene | - |
| Anti-CRISPR | - |