Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100206
Name   oriT_CloDF13 experimental
Organism   Escherichia coli
Sequence Completeness      incomplete
NCBI accession of oriT (coordinates [strand])   NC_002119 (9750..9762 [+], 13 nt)
oriT length   13 nt
IRs (inverted repeats)     _
Location of nic site      7..8
Conserved sequence flanking the
  nic site    		  _
Note   CloDF13 familiy

  oriT sequence  


Download         Length: 13 nt

>oriT_CloDF13
GTGGGTGGTCGGG

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
[2] Núñez B et al. (2001) Two atypical mobilization proteins are involved inplasmid CloDF13 relaxation. Mol Microbiol. 39(4):1088-99. [PMID:11251827]


Relaxase

ID   199 GenBank   NP_052376
Name   MobC_CloDF13 experimental UniProt ID   P08097
Length   148 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 148 a.a.        Molecular weight: 15933.34 Da        Isoelectric Point: 10.5193

>NP_052376.1 mobilization protein C (plasmid) [Escherichia coli]
MILRGCTMALERYNVSQPKRQAERGENTADPALAAGRACSTAELVARRLGIAAVQPVYRFLDTWWRKGCW
SGEITRLTAVRSACGADAARGGVLVRRGRAADGHYSVSCRRGVCAQLPRTGWPFELLRLAMEGNSRGAPA
GGTCTVLP

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB P08097

  Reference


[1] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
[2] Núñez B et al. (2001) Two atypical mobilization proteins are involved inplasmid CloDF13 relaxation. Mol Microbiol. 39(4):1088-99. [PMID:11251827]


T4CP

ID   199 GenBank   NP_052377
Name   MobB_CloDF13 experimental UniProt ID   P08098
Length   529 a.a. PDB ID   _
Note   Type IV Secretion System Coupling Protein

  T4CP protein sequence


Download         Length: 529 a.a.        Molecular weight: 57840.66 Da        Isoelectric Point: 11.1068

>NP_052377.1 mobilization protein B (plasmid) [Escherichia coli]
MGLSHKERREYGRSYKRDNNRTAPFSCWPRWIRPGGWSGHGGMSGTTRTGVTARLAFWGGWLSPCLSRAG
EKPSCVRTSTRTQIITCCSRLTCSGLPGARAGWLSGLCWRGSGVLLLDGHFAAADEAVNRKLNRRAGAQP
ATGEMTDVRQPAFRGAGTVNALARFFHGRGPETAGVFLGKDEQGEPVLVPRDTWRKTNIQILGLPGSGKS
VMATNALIRSVRDFGDAVVYFDQRGPVAALLPAHCPNFTLLDLRPGKPAQLNLFRDLDQYALKNLLVAGF
NLSETGHVADHYRISEQKAAKLIAEQVSAGGKHSAGAGGGVRAAGGPEKGREGADHQAGERGRPERPADG
QRHRRGGDNQRRRLLYVIGSMDDEAVIRVQKMLFARCAQIIIARDEFRRWPHASIMLDEIKYLLSKYVLN
ALGTVRSRDCNLRLAHHAGRLRAAGQDLPADFVKTTVLDNTPIRWFYRAASQESRSGAGQTGEIRVDVER
RGPAGRRGTWSISAGTASSRRSRPLFDVNTLQHLLTGSR

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB P08098

  Reference


[1] Buscher BA et al. (2005) The DotL protein, a member of the TraG-coupling protein family, is essential for Viability of Legionella pneumophila strain Lp02. J Bacteriol. 187(9):2927-38. [PMID:15838018]
[2] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
[3] Núñez B et al. (2001) Two atypical mobilization proteins are involved inplasmid CloDF13 relaxation. Mol Microbiol. 39(4):1088-99. [PMID:11251827]
[4] Cabezón E et al. (1994) Requirements for mobilization of plasmids RSF1010 and ColE1 by the IncW plasmid R388: trwB and RP4 traG are interchangeable. J Bacteriol. 176(14):4455-8. [PMID:8021231]


Host bacterium

ID   199 GenBank   NC_002119
Plasmid name   CloDF13 Incompatibility group   ColRNAI
Plasmid size   9957 bp Coordinate of oriT [Strand]   9750..9762 [+]
Host baterium   Escherichia coli

Cargo genes

Drug resistance gene   _
Virulence gene   _
Metal resistance gene   _
Degradation gene   _
Symbiosis gene   -
Anti-CRISPR   -