Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100205
Name   oriT_pSW100 in_silico
Organism   Pantoea stewartii subsp. stewartii SW2
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   L37403 ( , 32 nt)
oriT length   32 nt
IRs (inverted repeats)      5..8, 9..12  (TAGC..GCTA)
Location of nic site      28..29
Conserved sequence flanking the
  nic site    		  CTGG|CTTA
Note   _

  oriT sequence  


Download         Length: 32 nt

>oriT_pSW100
CACGTAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Dery KJ et al. (1997) Characterization of the replication and mobilization regions of the multiresistance Klebsiella pneumoniae plasmid pJHCMW1. Plasmid. 38(2):97-105. [PMID:9339467]


Auxiliary protein

ID   278 GenBank   AAC41487
Name   MobB_pSW100 insolico UniProt ID   Q52120
Length   139 a.a. PDB ID   _
Note   MbeB-like, N-term conserved region; pfam04837

  Auxiliary protein sequence


Download         Length: 139 a.a.        Molecular weight: 15433.68 Da        Isoelectric Point: 10.0926

>AAC41487.1 MobB (plasmid) [Plasmid pSW100]
MNSLLTLAKDLEQKSKVQQQSTGEMLKAAFSEHEKSVRAELSESEKRISAAILDHDRKLSSAMSQRTKGM
LRIVSQTWLTIVLVSVLLIASSAAILWWQSQQILDNYTTIREQKSTQAMLSERNSGVQLSTAAIRDAAA

  Protein domains


Predicted by InterproScan.

MbeB-like, N-term conserved region (MbeB_N)

(1-52)


  Protein structure


Source ID Structure
AlphaFold DB Q52120

  Reference


[1] Dery KJ et al. (1997) Characterization of the replication and mobilization regions of the multiresistance Klebsiella pneumoniae plasmid pJHCMW1. Plasmid. 38(2):97-105. [PMID:9339467]

ID   279 GenBank   AAC41486
Name   MobC_pSW100 insolico UniProt ID   Q52119
Length   107 a.a. PDB ID   _
Note   Bacterial mobilisation protein (MobC); pfam05713

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11778.48 Da        Isoelectric Point: 8.5631

>AAC41486.1 MobC (plasmid) [Plasmid pSW100]
MLTMWVTEDEQARLLERCDGKQLARWMRQTCLDEKPARAGKLPSLSPALLRQLAGMGNNLNQTARRVNSG
GGSGHDRVQVVAALMAIDAGLERLRHAVLEKGADDDR

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(50-94)


  Protein structure


Source ID Structure
AlphaFold DB Q52119

  Reference


[1] Dery KJ et al. (1997) Characterization of the replication and mobilization regions of the multiresistance Klebsiella pneumoniae plasmid pJHCMW1. Plasmid. 38(2):97-105. [PMID:9339467]


Host bacterium

ID   198 GenBank   L37403
Plasmid name   pSW100 Incompatibility group   ColRNAI
Plasmid size   4272 bp Coordinate of oriT [Strand]   _
Host baterium   Pantoea stewartii subsp. stewartii SW2

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -