Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100199
Name   oriT_pKJ36 in_silico
Organism   Bifidobacterium longum
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_002635 (3482..3513 [+], 32 nt)
oriT length   32 nt
IRs (inverted repeats)      1..8, 12..19  (ATGCAACC..GGTTGCAT)
Location of nic site      28..29
Conserved sequence flanking the
  nic site  
 
 TAAGTGCG|CCCT
Note   _

  oriT sequence  


Download         Length: 32 nt

>oriT_pKJ36
ATGCAACCTCCGGTTGCATGTAAGTGCGCCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
[2] Becker EC et al. (2003) Relaxed specificity of the R1162 nickase: a model for evolution of a system for conjugative mobilization of plasmids. J Bacteriol. 185(12):3538-46. [PMID:12775691]


Relaxase


ID   192 GenBank   NP_072178
Name   MobB_pKJ36 insolico UniProt ID   Q9F152
Length   346 a.a. PDB ID   
Note   MobA/MobL family; 39.0 kDa; pI=10.66; similar to plasmid pKJ50 MobA protein

  Relaxase protein sequence


Download         Length: 346 a.a.        Molecular weight: 39171.00 Da        Isoelectric Point: 10.8386

>NP_072178.1 mobilization protein MobB (plasmid) [Bifidobacterium longum]
MAIYHLSVSNVSRASGSRATATLSYITGKRVHDERRGETYDYGRKERVLRVGTLLPEGAPAEFADPAVLF
NAVELHETGRTARPAKKIVVALPREFTPRQRVQALEEYIRENLNADGYAATYAIHEDREGNNPHAHILVA
NRQIDPATGGWARLKQRMEYVLDERGERVPLIDPETGRQKTDKRGRRQWKRTSVSLNPLDRKAKLKALRE
SWAKTCNARLDETARIDHRSLEDQGSDLEPTIHEGYAARAIERAGGVSERCEANREIRRSNGLLTAIRTE
LGRIFDRLGELFAAKIRQLRQRQAERNRPRSRTGATSRATRAASSKPTGPTTRQRSVENSWEPRPT

  Protein domains


Predicted by InterproScan.

(19-253)


  Protein structure


Source ID Structure
AlphaFold DB Q9F152

  Reference


[1] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]


Host bacterium


ID   192 GenBank   NC_002635
Plasmid name   pKJ36 Incompatibility group   _
Plasmid size   3625 bp Coordinate of oriT [Strand]   3482..3513 [+]
Host baterium   Bifidobacterium longum

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -