Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 100198 |
Name | oriT_pRE25 |
Organism | Enterococcus faecalis |
Sequence Completeness | core |
NCBI accession of oriT (coordinates [strand]) | X92945 (19481..19518 [-], 38 nt) |
oriT length | 38 nt |
IRs (inverted repeats) | 1..12, 16..27 (ATACGAAGTAAC..GTTACTGCGTAT) |
Location of nic site | 33..34 |
Conserved sequence flanking the nic site |
TAAGTGC|GCCCT |
Note | The oriT is identical to oriT_pIP501 |
oriT sequence
Download Length: 38 nt
ATACGAAGTAACGAAGTTACTGCGTATAAGTGCGCCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileReference
[1] Becker EC et al. (2003) Relaxed specificity of the R1162 nickase: a model for evolution of a system for conjugative mobilization of plasmids. J Bacteriol. 185(12):3538-46. [PMID:12775691]
[2] Schwarz FV et al. (2001) Sequence of the 50-kb conjugative multiresistance plasmid pRE25 from Enterococcus faecalis RE25. Plasmid . 46(3):170-87. [PMID:11735367]
Relaxase
ID | 191 | GenBank | CAC29179 |
Name | Orf24_pRE25 | UniProt ID | Q79A51 |
Length | 654 a.a. | PDB ID | |
Note | relaxase |
Relaxase protein sequence
Download Length: 654 a.a. Molecular weight: 76493.35 Da Isoelectric Point: 9.3594
MTIAKRENGKRSLIAMASYRSGEKLYSELYEKTNLYNHRTVKPEAFILKPDYVPNEFLDRQTLWNKMELA
EKSPNAQLCREVNVALPIELNNSDQRMLIEDFVKDNFVNEGMIADVAIHRDDENNPHAHIMLTMREVDSE
GNILNKSHRIPKLDENGNQIFNEKGQRVTVSIKTNDWGRKSLVSEIRKDWADKVNQYLKDRNIDQQITEK
SHAELGKKELPTIHEGFYSKKLEDKGVISELKRKNLEIQSYNDILAELDKLENQEKVLKQDQNFTLKFEK
TFSPLEKGELKNLSKELKLFINDENIDKRLGELKRWENSLIFNNKMEIQKQRLMLSKISSERDMLTKANE
ILDKQAERFFKKSYPSLNIDKFSNHEVRAMVNETIFRKQLLNKDQLAEVIYNERVVEKEESKKIFKEKPF
QTSRYLDSKIKQIEDSITKENNPERKEILSIKKEKLIGIKQGLIEYVQSEVERKFDKNVSIDSVIEGEML
LAKADYYKTTDFSKVEGVARFSSEEINSMLEQSKGFLTNIQTVKIPNDCQGVFFVQDSMKHIDELSPLAK
QNLKKVVNRNAYLPDSDKIELSKEIENTNKDQSQELDKDVPEKNEVTVKMFQFAKSINRLLSGNQLQKKR
NLDKLIKQTKAKKNQSLQRNIPLR
Protein domains
Predicted by InterproScan.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q79A51 |
Reference
[1] Schwarz FV et al. (2001) Sequence of the 50-kb conjugative multiresistance plasmid pRE25 from Enterococcus faecalis RE25. Plasmid . 46(3):170-87. [PMID:11735367]
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 21976..34233
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
Locus_19 | 17008..17373 | + | 366 | CAC29175 | hypothetical protein | - |
Locus_20 | 17898..18404 | + | 507 | CAC29176 | hypothetical protein | - |
Locus_21 | 18765..19022 | - | 258 | CAC29177 | hypothetical protein | - |
Locus_22 | 19025..19324 | - | 300 | CAC29178 | hypothetical protein | - |
Locus_23 | 19637..21601 | + | 1965 | CAC29179 | nickase | - |
Locus_24 | 21625..21957 | + | 333 | CAC29180 | hypothetical protein | - |
Locus_25 | 21976..22359 | + | 384 | CAC29181 | hypothetical protein | trsC |
Locus_26 | 22433..23005 | + | 573 | CAC29182 | hypothetical protein | trsD |
Locus_27 | 23016..24977 | + | 1962 | CAC29183 | hypothetical protein | virb4 |
Locus_28 | 24991..26343 | + | 1353 | CAC29184 | hypothetical protein | trsF |
Locus_29 | 26365..27471 | + | 1107 | CAC29185 | hypothetical protein | orf14 |
Locus_30 | 27488..28039 | + | 552 | CAC29186 | hypothetical protein | - |
Locus_31 | 28044..28475 | + | 432 | CAC29187 | hypothetical protein | - |
Locus_32 | 28468..30123 | + | 1656 | CAC29188 | putative TrsK protein | - |
Locus_33 | 30141..30605 | + | 465 | CAC29189 | hypothetical protein | traP |
Locus_34 | 30601..31026 | + | 426 | CAC29190 | hypothetical protein | - |
Locus_35 | 31070..32002 | + | 933 | CAC29191 | putative TrsL protein | trsL |
Locus_36 | 32293..32988 | + | 696 | CAC29192 | hypothetical protein | - |
Locus_37 | 33017..33385 | + | 369 | CAC29193 | hypothetical protein | - |
Locus_38 | 33445..34233 | + | 789 | CAC29194 | hypothetical protein | prgC |
Locus_39 | 34550..34822 | + | 273 | CAC29195 | putative CopS protein | - |
Locus_40 | 35137..35823 | + | 687 | CAC29196 | transposase | - |
Locus_41 | 36346..37215 | + | 870 | CAC29197 | hypothetical protein | - |
Locus_42 | 37296..37721 | + | 426 | CAC29198 | hypothetical protein | - |
Locus_43 | 37965..38873 | + | 909 | CAC29199 | aminoglycoside 6-adenylyltranserase | - |
Host bacterium
ID | 191 | GenBank | X92945 |
Plasmid name | pRE25 | Incompatibility group | Inc18 |
Plasmid size | 50237 bp | Coordinate of oriT [Strand] | 19481..19518 [-] |
Host baterium | Enterococcus faecalis |
Cargo genes
Drug resistance gene | resitance to chloramphenicol, MLS (macrolide-lincosamide-streptogramin B) |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |