Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100196
Name   oriT_pKJ50 in_silico
Organism   Bifidobacterium longum
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_004978 (2462..2496 [+], 35 nt)
oriT length   35 nt
IRs (inverted repeats)      4..11, 15..22  (ATGTTACC..GGTAACAT)
Location of nic site      31..32
Conserved sequence flanking the
  nic site    		  TAAGTGCG|CCCT
Note   _

  oriT sequence  


Download         Length: 35 nt

>oriT_pKJ50
TGAATGTTACCACCGGTAACATGTAAGTGCGCCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Parker C et al. (2005) Elements in the co-evolution of relaxases and their origins of transfer. Plasmid . 53(2):113-8. [PMID:15737398]
[2] Becker EC et al. (2003) Relaxed specificity of the R1162 nickase: a model for evolution of a system for conjugative mobilization of plasmids. J Bacteriol. 185(12):3538-46. [PMID:12775691]
[3] Park MS et al. (1999) Sequence analysis of plasmid pKJ50 from Bifidobacterium longum. Microbiology. 145 ( Pt 3):585-92. [PMID:10217492]


Relaxase

ID   189 GenBank   AAD00257
Name   MobA_pKJ50 insolico UniProt ID   Q9ZA19
Length   345 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 345 a.a.        Molecular weight: 38568.15 Da        Isoelectric Point: 11.1211

>AAD00257.1 mobilization protein (plasmid) [Bifidobacterium longum]
MRDERTGEAFNGFGRRSASSMYARCCPRARPASTSTRSVCSTPSRWPRNVPTRGPRRRSWSPCPASSTPA
NAFRALEDFISWNITANGYACTYAIHTDKDGRNPHAHILVANRRIDPKTGRWAAKSRSEFALDANGRRIP
VIDPDTGRQKIGARNRKVWKRVNVSNNPLDSKEFLERLRREWADSCNALLPGYAVIDHRSFKARGIERIP
TIHEGYASREMEKRGGRGDLCEENRRIQALNRLLDALRAMIGRLSDQAQGILTAVKRRQRPSGAPQAPSS
PEPAERPQERPQARETPPQAPSSPEPAERPQERPQARETPATGPAGTPEAHQDEKGAHRQVQDTA

  Protein domains


Predicted by InterproScan.

MobA/MobL family (MobA_MobL)

(68-224)


  Protein structure


Source ID Structure
AlphaFold DB Q9ZA19

  Reference


[1] Parker C et al. (2005) Elements in the co-evolution of relaxases and their origins of transfer. Plasmid . 53(2):113-8. [PMID:15737398]


Host bacterium

ID   189 GenBank   NC_004978
Plasmid name   pKJ50 Incompatibility group   _
Plasmid size   4960 bp Coordinate of oriT [Strand]   2462..2496 [+]
Host baterium   Bifidobacterium longum

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -