Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100187
Name   oriT_pSK41 in_silico
Organism   Staphylococcus aureus
Sequence Completeness      incomplete
NCBI accession of oriT (coordinates [strand])   NC_005024 (10212..10223 [+], 12 nt)
oriT length   12 nt
IRs (inverted repeats)     _
Location of nic site      10..11
Conserved sequence flanking the
  nic site    		  TAAGTGCGCC|CT
Note   _

  oriT sequence  


Download         Length: 12 nt

>oriT_pSK41
TAAGTGCGCCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Grohmann E et al. (2003) Conjugative plasmid transfer in gram-positive bacteria. Microbiol Mol Biol Rev. 67(2):277-301. [PMID:12794193]
[2] Firth N et al. (1993) Analysis of a transfer region from the staphylococcal conjugative plasmid pSK41. Gene. 136(1-2):13-25. [PMID:8293996]


Relaxase

ID   180 GenBank   NP_863609
Name   Nes_pSK41 insolico UniProt ID   O87361
Length   665 a.a. PDB ID   
Note   MobA/MobL family; pfam03389

  Relaxase protein sequence


Download         Length: 665 a.a.        Molecular weight: 78908.86 Da        Isoelectric Point: 5.3910

>NP_863609.1 oriT nickase Nes (plasmid) [Staphylococcus aureus]
MAMYHFQNKFVSKANGQSATAKSAYNSASRIKDFKENEFKDYSNKQCDYSEILLPNNADDKFKDREYLWN
KVHDVENRKNSQVAREIIIGLPNEFDPNSNIELAKEFAESLSNEGMIVDLNIHKINEENPHAHLLCTLRG
LDKNNEFEPKRKGNDYIRDWNTKEKHNEWRKRWENVQNKHLEKNGFSVRVSADSYKNQNIDLEPTKKEGW
KARKFEDETGKKSSISKHNESIKKRNQQKIDKMFNEVDDMKSHKLNAFSYMNKSDSTTLKNMAKDLKIYV
TPINMYKENERLYDLKQKTSLITDDEDRLNKIEDIEDRQKKLESINEVFEKQAGIFFDKNYPDQSLNYSD
DEKIFITRTILNDRDVLPANNELEDIVKEKRIKEAQISLNTVLGNRDISLESIEKESNFFADKLSNILEK
NNLSFDDVLENKHEGMEDSLKIDYYTNKLEVFRNAENILEDYYDVQIKELFTDDEDYKAFNEVTDIKEKQ
QLIDFKTYHGTENTIEMLETGNFIPKYSDEDRKYITEQVKLLQEKEFKPNKNQHDKFVFGAIQKKLLSEY
DFDYSDNNDLKHLYQESNEVGDEISKDNIEEFYEGNDILVDKETYNNYNRKQQAYGLINAGLDSMIFNFN
EIFRERMPKYINHQYKGKNHSKQRHELKNKRGMHL

  Protein domains


Predicted by InterproScan.

MobA/MobL family (MobA_MobL)

(17-216)


  Protein structure


Source ID Structure
PDB 4HTE
AlphaFold DB O87361


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 25492..36713

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HKJ16_RS00115 (pSK41_p21) 21240..21644 - 405 WP_001242578 bleomycin binding protein -
HKJ16_RS00120 (pSK41_p22) 21861..22631 - 771 WP_001795128 aminoglycoside O-nucleotidyltransferase ANT(4')-Ia -
HKJ16_RS00125 22791..22937 - 147 WP_001817822 hypothetical protein -
HKJ16_RS00130 (pSK41_p23) 22981..23655 + 675 WP_001106019 IS6-like element IS257 family transposase -
HKJ16_RS00135 (pSK41_p24) 23764..23952 - 189 WP_001063224 hypothetical protein -
HKJ16_RS00140 (pSK41_p25) 24124..25098 + 975 WP_000368849 conjugative transfer protein TrsA -
HKJ16_RS00145 (pSK41_p26) 25115..25432 + 318 WP_000591622 CagC family type IV secretion system protein -
HKJ16_RS00150 (pSK41_p27) 25492..25899 + 408 WP_000110157 hypothetical protein trsC
HKJ16_RS00155 (pSK41_p28) 25886..26569 + 684 WP_000979860 TrsD/TraD family conjugative transfer protein trsD
HKJ16_RS00160 (pSK41_p29) 26584..28602 + 2019 WP_001795400 DUF87 domain-containing protein virb4
HKJ16_RS00165 (pSK41_p30) 28614..29894 + 1281 WP_000702361 membrane protein trsF
HKJ16_RS00170 (pSK41_p31) 29912..30988 + 1077 WP_000269385 CHAP domain-containing protein trsG
HKJ16_RS00175 (pSK41_p32) 30998..31483 + 486 WP_000735569 TrsH/TraH family protein -
HKJ16_RS00180 (pSK41_p33) 31499..33601 + 2103 WP_001094109 DNA topoisomerase III -
HKJ16_RS00185 (pSK41_p34) 33617..34081 + 465 WP_000715273 hypothetical protein trsJ
HKJ16_RS00190 (pSK41_p35) 34078..35718 + 1641 WP_000209436 VirD4-like conjugal transfer protein, CD1115 family -
HKJ16_RS00195 (pSK41_p36) 35796..36713 + 918 WP_011117679 conjugal transfer protein TrbL family protein trsL
HKJ16_RS00200 (pSK41_p37) 36730..37122 + 393 WP_000608970 single-stranded DNA-binding protein -
HKJ16_RS00205 (pSK41_p38) 37179..37346 + 168 WP_000869301 hypothetical protein -
HKJ16_RS00210 (pSK41_p39) 37384..38058 + 675 WP_011117680 IS6-like element IS257 family transposase -
HKJ16_RS00215 (pSK41_p40) 38162..39085 + 924 WP_001579520 protein rep -
HKJ16_RS00220 39616..39837 - 222 WP_000799767 hypothetical protein -
HKJ16_RS00225 (pSK41_p41) 40055..40378 - 324 WP_001146389 quaternary ammonium compound efflux SMR transporter QacC -
HKJ16_RS00230 40686..40916 + 231 WP_000956386 hypothetical protein -
HKJ16_RS00235 (pSK41_p42) 40946..41620 + 675 WP_001105984 IS6-like element IS257 family transposase -

Host bacterium

ID   180 GenBank   NC_005024
Plasmid name   pSK41 Incompatibility group   -
Plasmid size   46445 bp Coordinate of oriT [Strand]   10212..10223 [+]
Host baterium   Staphylococcus aureus

Cargo genes

Drug resistance gene   resistance to bleomycin, gentamicin, kanamycin, neomycin and tobramycin
Virulence gene   _
Metal resistance gene   _
Degradation gene   _
Symbiosis gene   -
Anti-CRISPR   -