Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100185
Name   oriT_pBBR1 experimental
Organism   Bordetella bronchiseptica
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_025015 (867..918 [-], 52 nt)
oriT length   52 nt
IRs (inverted repeats)      IR1: 3..14, 18..31  (TCACGACTTTGC..GCAAAGTCTAGTGA)
  IR2: 36..42, 43..50  (ACTCAAG..CATTGAGT)
Location of nic site      32..33
Conserved sequence flanking the
  nic site  
 
 TAGTGAG|TAT
Note   _

  oriT sequence  


Download         Length: 52 nt

>oriT_pBBR1
GGTCACGACTTTGCGAAGCAAAGTCTAGTGAGTATACTCAAGCATTGAGTGG

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Szpirer CY et al. (2001) Mobilization function of the pBHR1 plasmid, a derivative of the broad-host-range plasmid pBBR1. J Bacteriol. 183(6):2101-10. [PMID:11222611]


Relaxase


ID   178 GenBank   YP_009062863
Name   Mob_pBBR1 experimental UniProt ID   Q9Z5R6
Length   329 a.a. PDB ID   
Note   involved in mobilization

  Relaxase protein sequence


Download         Length: 329 a.a.        Molecular weight: 36707.68 Da        Isoelectric Point: 10.3259

>YP_009062863.1 Mob (plasmid) [Bordetella bronchiseptica]
MAAYAIMRCKKLAKMGNVAASLKHAYRERETPNADASRTPENEHWAASSTDEAMGRLRELLPEKRRKDAV
LAVEYVMTASPEWWKSASQEQQAAFFEKAHKWLADKYGADRIVTASIHRDETSPHMTAFVVPLTQDGRLS
AKEFIGNKAQMTRDQTTFAAAVADLGLQRGIEGSKARHTRIQAFYEALERPPVGHVTISPQAVEPRAYAP
QGLAEKLGISKRVETPEAVADRLTKAVRQGYEPALQAAAGAREMRKKADQAQETARDLRERLKPVLDALG
PLNRDMQAKAAAIIKAVGEKLLTEQREVQRQKQAQRQQERGRDRGGYSR

  Protein domains


Predicted by InterproScan.

(1-185)


  Protein structure


Source ID Structure
AlphaFold DB Q9Z5R6

  Reference


[1] Szpirer CY et al. (2001) Mobilization function of the pBHR1 plasmid, a derivative of the broad-host-range plasmid pBBR1. J Bacteriol. 183(6):2101-10. [PMID:11222611]


Host bacterium


ID   178 GenBank   NC_025015
Plasmid name   pBBR1 Incompatibility group   -
Plasmid size   2687 bp Coordinate of oriT [Strand]   867..918 [-]
Host baterium   Bordetella bronchiseptica

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -