Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100182
Name   oriT_pTC-F14 in_silico
Organism   Acidithiobacillus caldus
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_004734 (2024..2073 [-], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      3..18, 22..37  (CTTGGCGGGAACATGC..GCATGTGTATGACAAG)
Location of nic site      47..48
Conserved sequence flanking the
  nic site    		  CATCCTG|T
Note   _

  oriT sequence  


Download         Length: 50 nt

>oriT_pTC-F14
GGCTTGGCGGGAACATGCGTAGCATGTGTATGACAAGTCCCATCCTGTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Rawlings DE (2005) The evolution of pTF-FC2 and pTC-F14, two related plasmids of the IncQ-family. Plasmid. 53(2):137-47. [PMID:15737401]
[2] van Zyl LJ et al. (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022]


Relaxase

ID   175 GenBank   NP_835376
Name   MobA_pTC-F14 insolico UniProt ID   Q840R3
Length   889 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 889 a.a.        Molecular weight: 102296.78 Da        Isoelectric Point: 9.8238

>NP_835376.1 relaxase/primase-like fusion protein (plasmid) [Acidithiobacillus caldus]
MIVKKVKSNRTKGKAASIRDLTNYIREPQNRNPNEKVLYANGRGFISDTHAAQREEMVALAAEAVRSRNP
VNHYILSWREGEQPSPEQVEEAVSIFLDELGLQEHQVIYALHKDTDNLHLHIAVNRVHPETLKCVEINKG
FDLESAHRAIARIEHAQGWQREQNGRYEVLENGELGREHLEPNKRRQPEQRKRDKENRTGEKSAERIAIE
IGAPIIKQAQSWEQLHRELAAQGMRYEQKGSGALLWVGEVAVKASSADREASLGKLQKRLGAYEPAQAPS
PVAQRKPEPLQPDRPEWEDFMAGRKMHYAEKNAAKLSMDQRQEQERKALQARQQEQRKVLLGGRWNGKGE
ALNALRGVLAAEQAAEKAALKERHQQERQQWRQQYRPYPDFEQWLRREHGAEQATRWRYREAEPQRIEGD
STEAPKPRDIRAYRAEIVGQEVRYTPKSGAGGGPGGVSFVDKGRIIEIHDWRNQDTTLAALQLSAQKWGK
FTVTGNDEYKALCVKLAVEHGFQITNPELQEVIRQERQRMRQERAQAMKSEQIKPFERYAEAVGAERYRV
TSIKMRPDGSKQTFILDKRDGITRGFTPEEIAQRTPEMQRLQRRGENLYYTPLSEGKHHILIDDMDREKL
DRLIRDGYQPAVVLESSPGNYQAVITIPKLGTPFDKDVGNRLSDALNREYGDPKLSGAIHPHRAPGYENR
KPKHRREDGSYPEVRLLKAERRECGKTLALSREIDAGYQRQAAEKALKTPVEQFSEPNSTQTTPVSEKTA
TEAYWRHYRDVRKRQRGMLDLSRVDAMIAVRMRVTGFDQSAIEGAIYQCAPSIREQQESRDWTDYARRTA
RYAYSAAGDRQAADLGKYRQQWEKLEGRERQQEQAKAREIERNGPSMSR

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(17-272)

Large polyvalent protein-associated domain 7 (LPD7)

(453-527)

RepB DNA-primase from phage plasmid (RepB_primase)

(548-808)


  Protein structure


Source ID Structure
AlphaFold DB Q840R3

  Reference


[1] Rawlings DE (2005) The evolution of pTF-FC2 and pTC-F14, two related plasmids of the IncQ-family. Plasmid. 53(2):137-47. [PMID:15737401]
[2] van Zyl LJ et al. (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022]


Auxiliary protein

ID   252 GenBank   NP_835375
Name   MobB_pTC-F14 insolico UniProt ID   Q840R4
Length   103 a.a. PDB ID   _
Note   oriT recognition-like protein

  Auxiliary protein sequence


Download         Length: 103 a.a.        Molecular weight: 11210.91 Da        Isoelectric Point: 9.7756

>NP_835375.1 oriT recognition-like protein (plasmid) [Acidithiobacillus caldus]
MPFTVQGLEPLDAVVNVRLTASEKARLREDADLAGLSVSELVRRRYFGRPIVAHADAVLLKELRRIGGLL
KHVHNESGGAYSQQTAAVLVTLKAAIEGLSHDR

  Protein domains


Predicted by InterproScan.

Ribbon-helix-helix protein, copG family (RHH_1)

(15-44)


  Protein structure


Source ID Structure
AlphaFold DB Q840R4

  Reference


[1] Rawlings DE (2005) The evolution of pTF-FC2 and pTC-F14, two related plasmids of the IncQ-family. Plasmid. 53(2):137-47. [PMID:15737401]
[2] van Zyl LJ et al. (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022]

ID   253 GenBank   NP_835374
Name   MobC_pTC-F14 insolico UniProt ID   Q840R5
Length   131 a.a. PDB ID   _
Note   histone-like mobilization protein

  Auxiliary protein sequence


Download         Length: 131 a.a.        Molecular weight: 13984.96 Da        Isoelectric Point: 10.2555

>NP_835374.1 histone-like mobilization protein (plasmid) [Acidithiobacillus caldus]
MASSKQLYDIDAYAKKARTALENLEKTQQPGEVTGKGGKADVIRAIKSDLEALIKKGYTSKQIADALKHD
DVFGILPKTITEIVAGKKQNKSTVTRKKKSTTPAPTASGQANTAPIPQAGTFTVKPDSEDL

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB Q840R5

  Reference


[1] Rawlings DE (2005) The evolution of pTF-FC2 and pTC-F14, two related plasmids of the IncQ-family. Plasmid. 53(2):137-47. [PMID:15737401]
[2] van Zyl LJ et al. (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022]


Host bacterium

ID   175 GenBank   NC_004734
Plasmid name   pTC-F14 Incompatibility group   IncQ2
Plasmid size   14155 bp Coordinate of oriT [Strand]   2024..2073 [-]
Host baterium   Acidithiobacillus caldus

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -