Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100178
Name   oriT_pTF-FC2 experimental
Organism   Thiobacillus ferrooxidans FC1
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   M57717 (_)
oriT length   50 nt
IRs (inverted repeats)      1..18, 22..40  (CCGTTGGAACCACGTGGC..GCCATGTGTGTTACAACGG)
Location of nic site      48..49
Conserved sequence flanking the
  nic site    		  CATCCTG|T
Note   _

  oriT sequence  


Download         Length: 50 nt

>oriT_pTF-FC2
CGAATGGGCAGGCGTCCGTTGGAACCACGTGGCGAAGCCATGTGTGTTACAACGGTCATCCTGTATTGCTCAACCGCTCTACTATCATATCAGCAGTTTAGGCACACTAGATGCACTTTGCAACAAGCATAAAAGGCG

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Rawlings DE (2005) The evolution of pTF-FC2 and pTC-F14, two related plasmids of the IncQ-family. Plasmid. 53(2):137-47. [PMID:15737401]
[2] van Zyl LJ et al. (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022]
[3] Rohrer J et al. (1992) Sequence analysis and characterization of the mobilization region of a broad-host-range plasmid, pTF-FC2, isolated from Thiobacillus ferrooxidans. J Bacteriol. 174(19):6230-7. [PMID:1400173]


Relaxase

ID   171 GenBank   AAA27389
Name   MobA_pTF-FC2 insolico UniProt ID   P22898
Length   409 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 409 a.a.        Molecular weight: 46836.42 Da        Isoelectric Point: 9.5465

>AAA27389.1 ORF6, partial (plasmid) [Plasmid pTF-FC2]
MIALSQEAVRSKDTINHYVLSWREGEQPSPEQVEEAVSIFMDELGVKDHQAIYGLHADTDNLHLHLAINR
VHPETLKVVKINNGFDIEAAHKAIARIENAQGWQREQNGRYQVLENGELGREHIDKDKPRQPAQPKRDME
NRTGEKSAERIAIEDGAPIIKKAQTWEQLHRELAAKGMRYEKTGSGATLFVGDVGVKASSADRDASLSKL
QKRLGAYQPPQRQQVAQREPEPIKPDVPGWKDYITGRKAHYSEKNADKLVQDKRQEQERKQLAEQQKARR
DELMRGNWKGKGEVLNAMRSVIAAEQAAEKAALKEKHQKQREQHRQQFRPYPDLEQWQRMQKSPELAEQW
RHRASEPQRIEGDRSEPPTPRDIRAYQPEIVGQQVHYSRKEEGGRGGGVSFVDKGKSID

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(11-216)


  Protein structure


Source ID Structure
AlphaFold DB P22898

  Reference


[1] van Zyl LJ et al. (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022]


Auxiliary protein

ID   246 GenBank   B43256
Name   MobB_pTF-FC2 insolico UniProt ID   _
Length   106 a.a. PDB ID   _
Note   relaxosome component

  Auxiliary protein sequence


Download         Length: 106 a.a.        Molecular weight: 11618.45 Da        Isoelectric Point: 9.9109

>pir||B43256 mobilization protein mobB - Thiobacillus ferrooxidans plasmid pTF-FC2
MPFETQGPEPLDAVINVRLTAAEKARLKEDADLAGLSMSELVRRRYFGRPIIASADAVMLKELRRIGGLL
KHIHNESGGVYSKDTAGALVVLKAYIGKLSRDRQEG

  Protein domains



No domain identified.



  Protein structure



No available structure.



  Reference


[1] van Zyl LJ et al. (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022]

ID   247 GenBank   AAA27390
Name   MobC_pTF-FC2 insolico UniProt ID   P22899
Length   118 a.a. PDB ID   _
Note   relaxosome component

  Auxiliary protein sequence


Download         Length: 118 a.a.        Molecular weight: 12955.87 Da        Isoelectric Point: 10.2120

>AAA27390.1 ORF1 (plasmid) [Plasmid pTF-FC2]
MKYTTEQLEAIASKLRDMPQVEKKKQEHSKQEAVRVLSKEIAALQKRGYTLDQISETLRGEGLSIATPTL
KSYLQRAKPTKKAPVQAPGDTPPPAPAVKKPADTSKATFTPKPDSDDI

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB P22899

  Reference


[1] van Zyl LJ et al. (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022]


Host bacterium

ID   171 GenBank   M57717
Plasmid name   pTF-FC2 Incompatibility group   IncQ2
Plasmid size   5317 bp Coordinate of oriT [Strand]   1825..1962 [+]
Host baterium   Thiobacillus ferrooxidans FC1

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   contains merA (mercury reductase) gene
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -