Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100175
Name   oriT_pTF1 experimental
Organism   Acidithiobacillus ferrooxidans
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   X52699 (1025..1066 [-], 42 nt)
oriT length   42 nt
IRs (inverted repeats)      5..14, 18..27  (GGGTAATCTC..GAGATTACTC)
Location of nic site      34..35
Conserved sequence flanking the
  nic site    		  TAAGTGC|GCCCT
Note   _

  oriT sequence  


Download         Length: 42 nt

>oriT_pTF1
GCACGGGTAATCTCGAAGAGATTACTCTAAGTGCGCCCTTGC

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Parker C et al. (2005) Elements in the co-evolution of relaxases and their origins of transfer. Plasmid . 53(2):113-8. [PMID:15737398]
[2] Drolet M et al. (1992) Mobilization protein-DNA binding and divergent transcription at the transfer origin of the Thiobacillus ferrooxidans pTF1 plasmid. Mol Microbiol. 6(8):1061-71. [PMID:1584023]
[3] Cook DM et al. (1992) The oriT region of the Agrobacterium tumefaciens Ti plasmid pTiC58 shares DNA sequence identity with the transfer origins of RSF1010 and RK2/RP4 and with T-region borders. J Bacteriol. 174(19):6238-46. [PMID:1400174]


Relaxase

ID   168 GenBank   CAA36927
Name   MobL_pTF1 insolico UniProt ID   P20085
Length   378 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 378 a.a.        Molecular weight: 42636.53 Da        Isoelectric Point: 9.5530

>CAA36927.1 unnamed protein product [Acidithiobacillus ferridurans]
MAIYHLSAKPISRSAGRSATGAAAYRAGVEITDERTGLVHDYTRKGGVLHSELILPGGGTADRAEFWNGV
EAHHKRGDAVLVREIEISLPTELTAEQRKALAVGYARALADRYGVAADVALHAPRTVTDRELEKHPDQYH
ETDPKTGRRHNGNWHAHILLSACHVQPDGTLGKKAVELDPIHCQRAKIENLVDRERVRWGELANAALEHH
GHAARIDHRSHAKRGIEAEPTRHLGPAAAGIERRTGEESRRRHDFEREAMERLARAQAQGVLERESRGLE
RSIFDLSGDMRAAFQERDRLREQQERAERERREQERAREAQRQQEKQQADKAASDQREAERILAQLLEKA
PVVDRKTEKAIDGLFHDIARSRSRGRGR

  Protein domains


Predicted by InterproScan.

MobA/MobL family (MobA_MobL)

(17-244)


  Protein structure


Source ID Structure
AlphaFold DB P20085

  Reference


[1] Drolet M et al. (1992) Mobilization protein-DNA binding and divergent transcription at the transfer origin of the Thiobacillus ferrooxidans pTF1 plasmid. Mol Microbiol. 6(8):1061-71. [PMID:1584023]


Auxiliary protein

ID   241 GenBank   CAA36926
Name   MobS_pTF1 insolico UniProt ID   P20086
Length   98 a.a. PDB ID   _
Note   _

  Auxiliary protein sequence


Download         Length: 98 a.a.        Molecular weight: 11451.27 Da        Isoelectric Point: 10.4182

>CAA36926.1 unnamed protein product [Acidithiobacillus ferridurans]
MASFEEKIAAAEKRAQEAAKQVKQLKAKRDMVEARKLQSLLKGQRSDDTRRKILVGALVLDMMERDESTR
QRFMDRLDKYLTRADDRALFQLPIPEEK

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB P20086

  Reference


[1] Drolet M et al. (1992) Mobilization protein-DNA binding and divergent transcription at the transfer origin of the Thiobacillus ferrooxidans pTF1 plasmid. Mol Microbiol. 6(8):1061-71. [PMID:1584023]


Host bacterium

ID   168 GenBank   X52699
Plasmid name   pTF1 Incompatibility group   IncQ1
Plasmid size   2797 bp Coordinate of oriT [Strand]   1025..1066 [-]
Host baterium   Acidithiobacillus ferrooxidans

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -