Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100174
Name   oriT_pIP421 experimental
Organism   B.fragilis
Sequence Completeness      incomplete
NCBI accession of oriT (coordinates [strand])   Y10480 (513..519 [+], 7 nt)
oriT length   7 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   The oriT region was determined experimentally, but the putative nic site was not determined experimentally.

  oriT sequence  


Download         Length: 7 nt

>oriT_pIP421
CAAGCTC

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Trinh S et al. (1997) Identification and DNA sequence of the mobilization region of the 5-nitroimidazole resistance plasmid pIP421 from Bacteroides fragilis. J Bacteriol. 179(12):4071-4. [PMID:9190830]


Relaxase


ID   167 GenBank   CAA71505
Name   Mob421_pIP421 insolico UniProt ID   P96200
Length   425 a.a. PDB ID   
Note   A member of the Bacteroides mobilization protein family, which includes the MobA of pBI143, NBUs, and Tn4555

  Relaxase protein sequence


Download         Length: 425 a.a.        Molecular weight: 49267.97 Da        Isoelectric Point: 9.4676

>CAA71505.1 Mob421 protein (plasmid) [Bacteroides fragilis]
MAKTSINVRPCNIGSAERHNLRSKELDYIRPELSHRNEQWSEMKIADVLEDIREKYRQHTGQSMQKKATP
IREGVVVIEDGTTLRQLQDFAGRLEERFGIHTFQIYTHKDERASVWDGNAETWKPNYHAHMIFDWTDGET
GRTRKLNKQDMAEMQTILAECLGMERGISSDRKLLSAIQYKNMVEAEKAAQIEKECSQMEDERNAIEEKV
KQAGQKLEDTQKKLKEAAAEIKVEKLKGAAADTGTALLKAGTTVIDVTRSLFNSGKVKRQEQEIAELKRE
NYELEMKSQNLQSNLRTANAQNEREREATRRAVRTGEERLKPITNLFPCMENAKENIEELREMGVRDNDI
RLLLTGKEITYSGFLYDRERRKKHQVKNVKINIAKSKAGNTTIWLNDFHFKEFFKQLWQKLQKVLGIDKG
RGFHL

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB P96200

  Reference


[1] Trinh S et al. (1997) Identification and DNA sequence of the mobilization region of the 5-nitroimidazole resistance plasmid pIP421 from Bacteroides fragilis. J Bacteriol. 179(12):4071-4. [PMID:9190830]


Host bacterium


ID   167 GenBank   Y10480
Plasmid name   pIP421 Incompatibility group   -
Plasmid size   1861 bp Coordinate of oriT [Strand]   513..519 [+]
Host baterium   B.fragilis

Cargo genes


Drug resistance gene   5-nitroimidazole
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -