Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100172
Name   oriT_pSa in_silico
Organism   Escherichia coli
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   EU419764 (558..884 [-], 327 nt)
oriT length   327 nt
IRs (inverted repeats)      IR1: 105..112, 120..127  (AAGTCATT..AATGACTT)
  IR2: 131..136, 141..146  (CGCACC..GGTGCG)
  IR3: 246..255, 259..268  (CCCAATGCGC..GCGCATTGGG)
Location of nic site      154..155
Conserved sequence flanking the
  nic site  
 
 TGTCT|ATAGC
Note   _

  oriT sequence  


Download         Length: 327 nt

>oriT_pSa
CCTCTCCTGTAGTGTTTCCGTAGTGGTTCAATCCTAGCATTTACAAGGCTTTCCGCCAATATTGTAGTAGTCGAACACTACAGCGGTTTTCGTCCTTTGCGTGGAAGTCATTGTAAATCAATGACTTACGCGCACCGAAAGGTGCGTATTGTCTATAGCCCAGATTTAAGGATACCAACCCTGCTTTTAAGGACGAAAACCATGCCGATAACGCCAGCGTGACCCTAAAGAGGGTCAAAACTGCTCCCAATGCGCTATGCGCATTGGGTTATCGCGCAACAATGATGCACTTATAATGCTATGATAGTGCTACGATGATGCAGAAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Revilla C et al. (2008) Different pathways to acquiring resistance genes illustrated by the recent evolution of IncW plasmids. Antimicrob Agents Chemother. 52(4):1472-80. [PMID:18268088]


Auxiliary protein


ID   237 GenBank   ABZ82007
Name   TrwA_pSa insolico UniProt ID   Q04229
Length   121 a.a. PDB ID   _
Note   _

  Auxiliary protein sequence


Download         Length: 121 a.a.        Molecular weight: 13400.32 Da        Isoelectric Point: 4.8464

>ABZ82007.1 TrwA (plasmid) [Escherichia coli]
MALGDPIQVRLSPEKQALLEDEAARKGKRLATYLRELLESENDLQGELAALRREVVSLHHVIEDLADTGL
RSDQSGPGQNAVQIETLLLLRAIAGPERMKPVKGELKRLGIEVWTPEGKED

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB Q04229

  Reference


[1] Revilla C et al. (2008) Different pathways to acquiring resistance genes illustrated by the recent evolution of IncW plasmids. Antimicrob Agents Chemother. 52(4):1472-80. [PMID:18268088]


Host bacterium


ID   165 GenBank   EU419764
Plasmid name   pSa Incompatibility group   IncW
Plasmid size   1628 bp Coordinate of oriT [Strand]   558..884 [-]
Host baterium   Escherichia coli

Cargo genes


Drug resistance gene   resistance to chloramphenicol, gentamicin, kanamycin, streptomycin, spectinomycin and sulfonamide
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -