Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100168
Name   oriT_pNZ4000_2 experimental
Organism   Lactococcus cremoris
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_002137 ( 11306..11375 [-], 70 nt)
oriT length   70 nt
IRs (inverted repeats)      196..208, 221..233  (CATTGTAATACAA..TTGTATTACAATG)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   

  oriT sequence  


Download         Length: 70 nt

>oriT_pNZ4000_2
AAGCAACATTGTAATACAAGAACGAAGTGATTTGTATTACAATGTGATAGCTTGCAGTATTTATGGTTTT

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] van Kranenburg R et al. (1998) Characterization of multiple regions involved in replication and mobilization of plasmid pNZ4000 coding for exopolysaccharide production in Lactococcus lactis. J Bacteriol. 180(20):5285-90. [PMID:9765557]


Relaxase

ID   161 GenBank   NP_053037
Name   MobA_pNZ4000 insolico UniProt ID   O54677
Length   410 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 410 a.a.        Molecular weight: 47725.33 Da        Isoelectric Point: 9.0561

>NP_053037.1 mobilization protein (plasmid) [Lactococcus lactis subsp. cremoris]
MATIAKISNGASAASALNYALGQDRPMHEKTEQWLHDHQLERPVELTNCRAVAVGGTNGIDPFIAKEQFD
VVRQLHNQTKESNQVLRITQSFALDELNPKVQKDWQKANDLGVELAENLYPNHQSAVYTHLDGKNHVLHN
HIIVNKVNLETGKKLREQKGESVQRAREMNDRLASRENWHILEPPKERQTETEKELIAKNEYSYMNDLRE
RINKSLQDVSVSSYETFKERLSDNGVILSERGQTFSYAFLDANNKQRRARETRLGSDFGKETILHELENR
ARQNEFSAVEQREPAITPLERDTQQRESEIVSLEQAIEPRKSEARKRESKINRFIDTIKQFAGRVPELTQ
RVTRKLKQTKEKILDDFERRFSKDMKNYEQEQQKSLEKQANRDVQSEKKPTKDHDRGMSR

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(9-280)


  Protein structure


Source ID Structure
AlphaFold DB O54677

  Reference


[1] van Kranenburg R et al. (1998) Characterization of multiple regions involved in replication and mobilization of plasmid pNZ4000 coding for exopolysaccharide production in Lactococcus lactis. J Bacteriol. 180(20):5285-90. [PMID:9765557]


Auxiliary protein

ID   232 GenBank   NP_053038
Name   MobB_pNZ4000 insolico UniProt ID   O54678
Length   207 a.a. PDB ID   _
Note   putative mobilization protein

  Auxiliary protein sequence


Download         Length: 207 a.a.        Molecular weight: 24112.09 Da        Isoelectric Point: 7.1174

>NP_053038.1 putative mobilization protein (plasmid) [Lactococcus lactis subsp. cremoris]
MNKDEQLVVQVLNAYKNGKIDFSHVPELETLVRQEVNKEFRDYQEKIEAVASQKMESAIQEQLHRLEAEN
LKADILKEIQDEKQELITLKKELNEHQEQIKVDRKHAIVEHYSILIVNIICLFCFLVVGILIGRWIYKGI
WDGWGLHILYDTVMEIQPKHPYGAVVLGLGGFGLIAAGIYGSFRLMYTASTWFDQRPKIFKRIFPKK

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB O54678

  Reference


[1] van Kranenburg R et al. (1998) Characterization of multiple regions involved in replication and mobilization of plasmid pNZ4000 coding for exopolysaccharide production in Lactococcus lactis. J Bacteriol. 180(20):5285-90. [PMID:9765557]

ID   233 GenBank   NP_053039
Name   MobC_pNZ4000 insolico UniProt ID   O54679
Length   200 a.a. PDB ID   _
Note   putative mobilization protein

  Auxiliary protein sequence


Download         Length: 200 a.a.        Molecular weight: 23352.49 Da        Isoelectric Point: 4.6155

>NP_053039.1 putative mobilization protein (plasmid) [Lactococcus lactis subsp. cremoris]
MVLDNKLGLTNSAELAKQEELLTKKRAKELFESGKIEDLEIGTFQGLSDIHQFLFQDIYDFAGKIREVNI
AKGNFQFAPRIFLAQTLEYIDKLPQETFDEIIDKYSDMNVAHPFREGNGRATRIWLDLILQNKLHKIVDW
NQIDKDEYLNAMIRSTVSTNELKYLIQKALTDDLGKEQFFKGIDASYYYEGYYEIKTEDL

  Protein domains


Predicted by InterproScan.

Fic/DOC family (Fic)

(46-130)


  Protein structure


Source ID Structure
AlphaFold DB O54679

  Reference


[1] van Kranenburg R et al. (1998) Characterization of multiple regions involved in replication and mobilization of plasmid pNZ4000 coding for exopolysaccharide production in Lactococcus lactis. J Bacteriol. 180(20):5285-90. [PMID:9765557]


Host bacterium

ID   161 GenBank   NC_002137
Plasmid name   pNZ4000 Incompatibility group   _
Plasmid size   42810 bp Coordinate of oriT [Strand]   28811..28880 [+]; 11306..11375 [-]
Host baterium   Lactococcus cremoris

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -