Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100160
Name   oriT_pGI1 in_silico
Organism   Bacillus thuringiensis serovar thuringiensis
Sequence Completeness      incomplete
NCBI accession of oriT (coordinates [strand])   NC_004335 (6421..6446 [+], 26 nt)
oriT length   26 nt
IRs (inverted repeats)      1..10, 17..26  (GTAAACTGTA..TACAGTTTAC)
Location of nic site      15..16
Conserved sequence flanking the
  nic site  
 
 TAGTGTG|CTA
Note   pMV158 superfamily

  oriT sequence  


Download         Length: 26 nt

>oriT_pGI1
GTAAACTGTAGTGTGCTACAGTTTAC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Andrup L et al. (2003) The patchwork nature of rolling-circle plasmids: comparison of six plasmids from two distinct Bacillus thuringiensis serotypes. Plasmid. 49(3):205-32. [PMID:12749835]


Relaxase


ID   154 GenBank   NP_705753
Name   Mob1_pGI1 insolico UniProt ID   Q8GLD2
Length   401 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 401 a.a.        Molecular weight: 47546.29 Da        Isoelectric Point: 9.9007

>NP_705753.1 Mob1 (plasmid) [Bacillus thuringiensis serovar thuringiensis]
MSKFMVCHMQKFKMTDVKGLQIHNQREKESHSNSDIIQERTEQNYDLIHDKRKVDYKKIIQNRIDNGVVS
NRAIRKDAVVCCSFMISASPDYMNFLSPVEQRRFFEESVCFLKARYGEENFVYASVHVDEKTPHMHVGMV
PVNEKQKLSAYSFFKNKSELHDLQDKIYEHVKEKGFDIERGVSSDRKHLSTQRFKAVTLQQEIEKLEQEK
KEIDSRLYDLKFSLNQAKSVDEIPVKEKGGFIRSKTVEIDSEDFESIKVLAKSSEVLRSENRRLKNEKIK
IEREKDDLYKGQRFLERQVTDLKRENRGLKEANDFLKKTLERVKEMYKEKLPELAGMIGYVKGSILDKMN
RKFLKRHFAGDDEVRGAQKFLNHKQEHEEQQKRLKQVRRSQQKNRDQGLER

  Protein domains


Predicted by InterproScan.

(1-196)


  Protein structure


Source ID Structure
AlphaFold DB Q8GLD2

  Reference


[1] Andrup L et al. (2003) The patchwork nature of rolling-circle plasmids: comparison of six plasmids from two distinct Bacillus thuringiensis serotypes. Plasmid. 49(3):205-32. [PMID:12749835]


Host bacterium


ID   154 GenBank   NC_004335
Plasmid name   pGI1 Incompatibility group   -
Plasmid size   8254 bp Coordinate of oriT [Strand]   6421..6446 [+]
Host baterium   Bacillus thuringiensis serovar thuringiensis

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -