Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100148
Name   oriT_pSMA23 in_silico
Organism   Lacticaseibacillus casei
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_010242 (529..556 [+], 28 nt)
oriT length   28 nt
IRs (inverted repeats)      3..12, 20..29  (GTAAAGTATA..TATACCTTAC)
Location of nic site      16..17
Conserved sequence flanking the
  nic site  
 
 TATTGG|GCTAT
Note   pMV158 superfamily; nick site (TGG|G)

  oriT sequence  


Download         Length: 28 nt

>oriT_pSMA23
AGGTAAAGTATATTGGGCTATACCTTAC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Sudhamani M et al. (2008) Characterisation of pSMA23, a 3.5 kbp plasmid of Lactobacillus casei, and application for heterologous expression in Lactobacillus. Plasmid. 59(1):11-9. [PMID:17961648]


Relaxase


ID   142 GenBank   YP_001649176
Name   Mob_pSMA23 insolico UniProt ID   Q45TE0
Length   364 a.a. PDB ID   
Note   clade A of the pMV158-superfamily of relaxases

  Relaxase protein sequence


Download         Length: 364 a.a.        Molecular weight: 42121.57 Da        Isoelectric Point: 9.7310

>YP_001649176.1 mobilization protein (plasmid) [Lactobacillus casei]
MSYLVANMQKLKADNLVGLGNHDQRRTQHHKNPDIDVDRSALNYDLVAGRTGHFKKTDIEAYINEHKTSQ
RAVRKDAVLVNEWIISSDSHFFADLTAADMRKYFETAKDYFAEKFGEENIRYAIVHLDESTPHMHMGIVP
FDDEHKLSAKRVFNRTALRDVQDQLPAYLQQHGFNIQRGVQESERKSLTVPEYKAMRESIKQSQQKLAAV
ENETKQRQAKLKTYQATKFDVNSVKTKESRFHKRYVLVDRFDFDKLKQGASLTDTYFTETLSQRSDMDIQ
KDQLIKAESKAMELDIENRRLQKLVGTLQGIVRSVDRFLQRKLGVGLPSEWLERAGLKEPSKKAPQRPQE
RSEGQHDKLDGPSL

  Protein domains


Predicted by InterproScan.

(1-195)


  Protein structure


Source ID Structure
AlphaFold DB Q45TE0

  Reference


[1] Sudhamani M et al. (2008) Characterisation of pSMA23, a 3.5 kbp plasmid of Lactobacillus casei, and application for heterologous expression in Lactobacillus. Plasmid. 59(1):11-9. [PMID:17961648]


Host bacterium


ID   142 GenBank   NC_010242
Plasmid name   pSMA23 Incompatibility group   -
Plasmid size   3497 bp Coordinate of oriT [Strand]   529..556 [+]
Host baterium   Lacticaseibacillus casei

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -