Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100147
Name   oriT_pH205 in_silico
Organism   Klebsiella pneumoniae
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_010261 (7094..7311 [-], 218 nt)
oriT length   218 nt
IRs (inverted repeats)      IR1: 46..53, 57..64  (TTCGGGGC..GCCCTGAA)
  IR2: 77..80, 81..84  (CGCT..AGCG)
Location of nic site      97..98
Conserved sequence flanking the
  nic site  
 
 CTGG|CTAA
Note   ColE1 superfamily

  oriT sequence  


Download         Length: 218 nt

>oriT_pH205
GATGGCATGGGGTGATATCCAGTAGCGGAGAGGTTGTTAGCGGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTAAATATGTTACGGCGGAGTGGTGATTTATGAAAGTGCTTCATGTGACAAGGGAAAAAATGCGGCTACCGGGCGTAAGTGCAACATGCAGGTAAGGATGAAATGACGCCTCCTCGCTCAC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Zioga A et al. (2009) CMY-31 and CMY-36 cephalosporinases encoded by ColE1-like plasmids. Antimicrob Agents Chemother. 53(3):1256-9. [PMID:19104021]


Relaxase


ID   141 GenBank   YP_001649335
Name   MobB_pH205 insolico UniProt ID   B0FJX9
Length   156 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 156 a.a.        Molecular weight: 17556.39 Da        Isoelectric Point: 9.3491

>YP_001649335.1 relaxase (plasmid) [Klebsiella pneumoniae]
MQQAIRMRIEADSASGKMTETVRQSVNAALTQVEKELKQTGLEQQKPATDAFNQAAGTAKAMIHEMRREM
SRYTWKSAIYIAMTMIAVMGGCLWGMYYFIDSGYARVAEMQHMEAVWQKKAPLADIKTCDGNPCVKVDIS
RTFGDKKDTYLIIKGK

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB B0FJX9

  Reference


[1] Zioga A et al. (2009) CMY-31 and CMY-36 cephalosporinases encoded by ColE1-like plasmids. Antimicrob Agents Chemother. 53(3):1256-9. [PMID:19104021]


Host bacterium


ID   141 GenBank   NC_010261
Plasmid name   pH205 Incompatibility group   _
Plasmid size   8197 bp Coordinate of oriT [Strand]   7094..7311 [-]
Host baterium   Klebsiella pneumoniae

Cargo genes


Drug resistance gene   CMY-31 cephalosporinase (blaCMY-type gene)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -