Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100142
Name   oriT_pLB925A02 in_silico
Organism   Levilactobacillus brevis
Sequence Completeness      incomplete
NCBI accession of oriT (coordinates [strand])   NC_012549 (_)
oriT length   23 nt
IRs (inverted repeats)      3..9, 16..23  (AAGTATA..TATACCTT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   _

  oriT sequence  


Download         Length: 23 nt

>oriT_pLB925A02
TAAAGTATATTGGGCTATACCTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Wada T et al. (2009) Characterization of four plasmids harboured in a Lactobacillus brevis strain encoding a novel bacteriocin, brevicin 925A, and construction of a shuttle vector for lactic acid bacteria and Escherichia coli. Microbiology. 155(Pt 5):1726-37. [PMID:19372160]


Relaxase

ID   136 GenBank   YP_002790952
Name   MobA_pLB925A02 insolico UniProt ID   C0SQL3
Length   361 a.a. PDB ID   
Note   putative plasmid mobilization protein

  Relaxase protein sequence


Download         Length: 361 a.a.        Molecular weight: 41701.82 Da        Isoelectric Point: 7.6901

>YP_002790952.1 putative plasmid mobilization protein (plasmid) [Lactobacillus brevis]
MSYLVANMQKLKADNLVGLGNHDQRRTQHHKNTDIEVDRSGLNYDLVAGRTNHFKTDIAAYINEHKTSQR
AVRKDAVLVDEWIISSDSNFFANLTAADTRKYFETAKAYFAEKFGEENVRYAIVHLDESTPHMHMGIVPF
DDEYKLSAKRVFNRAALQNVQDQLPTYLQQHGFNIQRGVQESERKSLTVPEYKAMREDLKKATLQKQEIQ
AELEDARKRLAELKPRDQQEIESKPTFLSKDKVVVRKSDLHDLESRAAVSDIYNQQQNRLKLDNQSLNYQ
LLEVKDNNYELSKKNEKLQKLVDTLQGIVRSVDRFLQRKLGVGLPSEWLERAGLKEPSKNAPQRPQERSE
GQHDELDGPSL

  Protein domains


Predicted by InterproScan.

Plasmid recombination enzyme (Mob_Pre)

(1-194)


  Protein structure


Source ID Structure
AlphaFold DB C0SQL3

  Reference


[1] Wada T et al. (2009) Characterization of four plasmids harboured in a Lactobacillus brevis strain encoding a novel bacteriocin, brevicin 925A, and construction of a shuttle vector for lactic acid bacteria and Escherichia coli. Microbiology. 155(Pt 5):1726-37. [PMID:19372160]


Host bacterium

ID   136 GenBank   NC_012549
Plasmid name   pLB925A02 Incompatibility group   _
Plasmid size   3524 bp Coordinate of oriT [Strand]   
Host baterium   Levilactobacillus brevis

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -