Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100141
Name   oriT_pLB925A03 in_silico
Organism   Levilactobacillus brevis
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_012550 (_)
oriT length   47 nt
IRs (inverted repeats)      15..18, 24..27  (TGTC..GACA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   _

  oriT sequence  


Download         Length: 47 nt

>oriT_pLB925A03
CGAAGCAAAATGTATGTCATTCCGACAGCTTGCATTATTTGTTTTTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Wada T et al. (2009) Characterization of four plasmids harboured in a Lactobacillus brevis strain encoding a novel bacteriocin, brevicin 925A, and construction of a shuttle vector for lactic acid bacteria and Escherichia coli. Microbiology. 155(Pt 5):1726-37. [PMID:19372160]


Relaxase

ID   135 GenBank   YP_002790959
Name   MobA_pLB925A03 insolico UniProt ID   C0SQM0
Length   415 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 415 a.a.        Molecular weight: 47675.38 Da        Isoelectric Point: 10.0544

>YP_002790959.1 putative plasmid mobilization protein (plasmid) [Lactobacillus brevis]
MATIAKVTNGASAASALDYALGKDKPLHEHTERWLEENRLERLDALKDCRAVAVGGTNGIDPVIAKEQFK
AVQQAFNQTARRNQVLRITQSFALNELDPTNTRDWQRANDLGCELAEKLYPDYQTAVYTHLDGQNHILHN
HIIINKVNLQTGKKLDERKGSAVERARNANDEISKEQGWKVIEPVREHQSRTEQDLTKKGQYSYMHDLRG
RIDTTMQDTSICDFKTFSDVLARSGVNVSVRGQNVSYAFLDANKKQRRARGKRLGTDYEKETILNELERR
TRERTAQQLDREDQSRATELVRETTSTDTALEQRERQAQSRKPRIDQLRNAVKPIADHLQHFTGAVREFA
GKVEQRVIDSKLYKDVASRFKADLAKQEQARQNAIKQDLAKRMAPKKQPQQPQRSYYREPEGRSR

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(9-280)


  Protein structure


Source ID Structure
AlphaFold DB C0SQM0

  Reference


[1] Wada T et al. (2009) Characterization of four plasmids harboured in a Lactobacillus brevis strain encoding a novel bacteriocin, brevicin 925A, and construction of a shuttle vector for lactic acid bacteria and Escherichia coli. Microbiology. 155(Pt 5):1726-37. [PMID:19372160]


Auxiliary protein

ID   198 GenBank   YP_002790960
Name   MobB_pLB925A03 insolico UniProt ID   C0SQM1
Length   222 a.a. PDB ID   _
Note   putative plasmid mobilization protein

  Auxiliary protein sequence


Download         Length: 222 a.a.        Molecular weight: 25491.51 Da        Isoelectric Point: 8.7567

>YP_002790960.1 putative plasmid mobilization protein (plasmid) [Lactobacillus brevis]
MSQNEELARQILLAYANGKVDLSKVPELQRIVKEAAAEQMAYTVNTNDLQQKQADALKRSEIWLNEQAHA
RLDAINPDQLKQEFVTSVEDYERRLKAQQSELESLLEQSEKSRRQQFWRNLMPTLAGSAVCLLLVAVIFF
VLEKLIYQGIWQGWGLHKLYATVLAIQPQHPYGAIVLGLLGFVLLAGALYASFWLLVHAVQQLVDFKPSK
LLFWKKQNNTRW

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB C0SQM1

  Reference


[1] Wada T et al. (2009) Characterization of four plasmids harboured in a Lactobacillus brevis strain encoding a novel bacteriocin, brevicin 925A, and construction of a shuttle vector for lactic acid bacteria and Escherichia coli. Microbiology. 155(Pt 5):1726-37. [PMID:19372160]

ID   199 GenBank   YP_002790958
Name   MobC_pLB925A03 insolico UniProt ID   C0SQL9
Length   112 a.a. PDB ID   _
Note   putative plasmid mobilization protein

  Auxiliary protein sequence


Download         Length: 112 a.a.        Molecular weight: 12973.91 Da        Isoelectric Point: 10.7446

>YP_002790958.1 putative plasmid mobilization protein (plasmid) [Lactobacillus brevis]
MTNIKANSDKQTKRINFRLNELEYEKLSQSASTYGLKVSSYAKQLALKSNLRKPYFSASDTQQIILELTR
QGTNLNQITRKLNQGDPLTPAMLAEIKKMQEAQRQLWRQLQK

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(67-112)


  Protein structure


Source ID Structure
AlphaFold DB C0SQL9

  Reference


[1] Wada T et al. (2009) Characterization of four plasmids harboured in a Lactobacillus brevis strain encoding a novel bacteriocin, brevicin 925A, and construction of a shuttle vector for lactic acid bacteria and Escherichia coli. Microbiology. 155(Pt 5):1726-37. [PMID:19372160]


Host bacterium

ID   135 GenBank   NC_012550
Plasmid name   pLB925A03 Incompatibility group   _
Plasmid size   8881 bp Coordinate of oriT [Strand]   
Host baterium   Levilactobacillus brevis

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -