Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100136
Name   oriT_pLAC1 in_silico
Organism   Ligilactobacillus acidipiscis
Sequence Completeness      incomplete
NCBI accession of oriT (coordinates [strand])   NC_014164 (_)
oriT length   32 nt
IRs (inverted repeats)      5..13, 20..28  (TAAAGTATA..TATACTTTA)
Location of nic site      17..18
Conserved sequence flanking the
  nic site    		  TAGTGA|GTTAT
Note   pMV158 superfamily; nick site (TGA鈥睪)

  oriT sequence  


Download         Length: 32 nt

>oriT_pLAC1
AACATAAAGTATAGTGAGTTATACTTTACTTG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Asteri IA et al. (2010) Characterization of a small cryptic plasmid from endophytic Pantoea agglomerans and its use in the construction of an expression vector. Int J Food Microbiol. 141(3):222-8. [PMID:20538362]


Relaxase

ID   131 GenBank   YP_003650630
Name   Mob_pLAC1 insolico UniProt ID   D6CHH5
Length   361 a.a. PDB ID   
Note   clade A of the pMV158-superfamily of relaxases

  Relaxase protein sequence


Download         Length: 361 a.a.        Molecular weight: 41648.01 Da        Isoelectric Point: 9.3442

>YP_003650630.1 mobilization protein (plasmid) [Lactobacillus acidipiscis]
MSFAVARMTKLKADNLVGIGNHDQRKTTNHSNEDIDVSRSHLNYDLVAGRTDNFKTDIEAYINENKASKR
AVRKDAVLVNEWIITSDKDFFEQLDEAETRKYFETAKQYFADNYGDENIRYAVVHMDEKTPHMHMGIVPF
DDGKKLSAKRIFNREALQRIQEELPQYLKENGFDVQRGNKNKERKNLSVPEYKAMREDLKKIETEKQETQ
AKLADTKKQLDRIKPRDTKKIASKPTLMNKNKVTVDKSDLADLEQRAVTSDAYNFEKIHLEVENHSLRND
LGEAKGQNYELKKENERLQKLVGTLQGIIRNVDGFLHKKLGINLPEKWLERAGLKEPSKKAPESSQELGK
HKSDELGGPHL

  Protein domains


Predicted by InterproScan.

Plasmid recombination enzyme (Mob_Pre)

(1-194)


  Protein structure


Source ID Structure
AlphaFold DB D6CHH5

  Reference


[1] Asteri IA et al. (2010) Characterization of a small cryptic plasmid from endophytic Pantoea agglomerans and its use in the construction of an expression vector. Int J Food Microbiol. 141(3):222-8. [PMID:20538362]


Host bacterium

ID   131 GenBank   NC_014164
Plasmid name   pLAC1 Incompatibility group   -
Plasmid size   3478 bp Coordinate of oriT [Strand]   
Host baterium   Ligilactobacillus acidipiscis

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -