Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100131
Name   oriT_pEC34A in_silico
Organism   Escherichia coli
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_019077 (_)
oriT length   108 nt
IRs (inverted repeats)      38..57, 60..79  (GTAATTGTAATAGCGTGCAT..ATGCGCGGTATAACAATTAC)
Location of nic site      87..88
Conserved sequence flanking the
  nic site    		  CATCCTG|T
Note   _

  oriT sequence  


Download         Length: 108 nt

>oriT_pEC34A
TATCTGACATGGGTGTCGGGGCAAAGCCCTGACCAGGGTAATTGTAATAGCGTGCATGCATGCGCGGTATAACAATTACACATCCTGTCCTGTCAGCAAGTTCGAATT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   189 GenBank   YP_006953579
Name   Mob_pEC34A insolico UniProt ID   G9BMJ2
Length   115 a.a. PDB ID   _
Note   conjugal transfer relaxosome component TraJ

  Auxiliary protein sequence


Download         Length: 115 a.a.        Molecular weight: 13000.12 Da        Isoelectric Point: 10.4044

>YP_006953579.1 plasmid mobility protein (plasmid) [Escherichia coli]
MSDTEPCFMTKRSGSNTRRRAICRPVRLTAEEDQEIRKRAAECGKTVSGFLRAAALGKKVNSLTDDRVLK
EVMRLGALQKKLFIDGKRVGDREYAEVLIAITEYHRALLSRLMAD

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB G9BMJ2


Host bacterium

ID   126 GenBank   NC_019077
Plasmid name   pEC34A Incompatibility group   ColRNAI
Plasmid size   3770 bp Coordinate of oriT [Strand]   
Host baterium   Escherichia coli

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -