Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100126
Name   oriT_pREN in_silico
Organism   Loigolactobacillus rennini
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_019233 (_)
oriT length   95 nt
IRs (inverted repeats)      IR1: 1..9, 28..36  (AAAAGCCGA..TCGGCTTTT)
  IR2: 54..66, 67..79  (TGTCCTTTTTTTG..CAAAAAAAGGGCA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   almost identical to that of the pLJ42 plasmid (100% query coverage with 97% identity)

  oriT sequence  


Download         Length: 95 nt

>oriT_pREN
AAAAGCCGATTTGCGAACAGCAAACTTTCGGCTTTTTTTGTGCGGTTTTTTTGTGTCCTTTTTTTGCAAAAAAAGGGCAGGTTTTCGGGTTTGAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Asteri IA et al. (2011) Comparative and evolutionary analysis of plasmid pREN isolated from Lactobacillus rennini, a novel member of the theta-replicating pUCL287 family. FEMS Microbiol Lett. 318(1):18-26. [PMID:21291494]


Auxiliary protein

ID   181 GenBank   YP_006960895
Name   MobB_pREN insolico UniProt ID   E3Q0R1
Length   243 a.a. PDB ID   _
Note   _

  Auxiliary protein sequence


Download         Length: 243 a.a.        Molecular weight: 27695.08 Da        Isoelectric Point: 8.7301

>YP_006960895.1 hypothetical protein (plasmid) [Lactobacillus rennini]
MSQNEELARQILLAYANGKVDLSKVPELQSTSILLAYANGKVDLSKVPELQRIVKEAAAEQMAYTVNTND
LQQKQADALKRSEIWLNEQAHARLDAINPDQLKQEFVTSVEDYERRLKAQQSELKSLLEQSEKSRRQQFW
RNLMPTLAGSAVCLLLVAVIFFVLEKLIYQGIWQGWGLHKLYATVLAIQPQHPYGAIVLGLLGFVLLAGA
LYASFWLLVHVVQQLVDFQPSKLLFWRKHDNPR

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB E3Q0R1

  Reference


[1] Asteri IA et al. (2011) Comparative and evolutionary analysis of plasmid pREN isolated from Lactobacillus rennini, a novel member of the theta-replicating pUCL287 family. FEMS Microbiol Lett. 318(1):18-26. [PMID:21291494]

ID   182 GenBank   YP_006960894
Name   MobC_pREN insolico UniProt ID   E3Q0R0
Length   112 a.a. PDB ID   _
Note   mobilization protein

  Auxiliary protein sequence


Download         Length: 112 a.a.        Molecular weight: 12944.87 Da        Isoelectric Point: 10.6780

>YP_006960894.1 MobC protein (plasmid) [Lactobacillus rennini]
MANIKANSDKQTKRINFRLNELEYEKLSQSASTYGLTVSSYAKQLALKSNLRKPYFSASDTQQIILELTR
QGTNLNQITRKLNQGDPLTPAMLAEIKKMQEVQRQLWRQLQK

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(67-111)


  Protein structure


Source ID Structure
AlphaFold DB E3Q0R0

  Reference


[1] Asteri IA et al. (2011) Comparative and evolutionary analysis of plasmid pREN isolated from Lactobacillus rennini, a novel member of the theta-replicating pUCL287 family. FEMS Microbiol Lett. 318(1):18-26. [PMID:21291494]


Host bacterium

ID   121 GenBank   NC_019233
Plasmid name   pREN Incompatibility group   -
Plasmid size   4371 bp Coordinate of oriT [Strand]   
Host baterium   Loigolactobacillus rennini

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -