Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100124
Name   oriT_pMBLT00 in_silico
Organism   UNVERIFIED: Leuconostoc mesenteroides subsp. mesenteroides strain KCTC 13302
Sequence Completeness      incomplete
NCBI accession of oriT (coordinates [strand])   JN106352 (17020..17039 [-], 20 nt)
oriT length   20 nt
IRs (inverted repeats)      1..9, 12..20  (CTCGTAAAA..TTTTTCGAG)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   

  oriT sequence  


Download         Length: 20 nt

>oriT_pMBLT00
CTCGAAAAAGGTTTTACGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Chae HS et al. (2013) Use of a novel Escherichia coli-leuconostoc shuttle vector for metabolic engineering of Leuconostoc citreum to overproduce D-lactate. Appl Environ Microbiol. 79(5):1428-35. [PMID:23241984]


Relaxase


ID   119 GenBank   AFJ91158
Name   MobA_pMBLT00 insolico UniProt ID   I6Q9D0
Length   309 a.a. PDB ID   
Note   mobilization protein; binds to an origin of transfer (oriT).

  Relaxase protein sequence


Download         Length: 309 a.a.        Molecular weight: 35521.10 Da        Isoelectric Point: 6.3756

>AFJ91158.1 mobilization protein (plasmid) [Leuconostoc mesenteroides subsp. mesenteroides]
MAHLKKNTRGAVPGLAVHFERKTDHHTNKDIDVSKTYLNQDLMTDGSDMISRFNDRLSDVYCMKRDDVKA
LATWIVTLPEELAEASYEQQEAFFEETKHFLDERYGKENTMAAVVHYDETTPHLHYAFVPVVFDAKKERY
KVSAKQVLTRHDLQTFHDDLDQDLKKVLPFYEKGVLNNKTLPFENVAEIKKYNDQFKALKDELTNVEENI
SAKKALLKITNQELDEVDLAEKQIDDFKQALSKNLFGKTVIKPDDLDRFKTVLANMKKATLQSQRNAEQT
SHELSKVKEQLADAKAEHQNLKISSATSG

  Protein domains


Predicted by InterproScan.

(1-167)


  Protein structure


Source ID Structure
AlphaFold DB I6Q9D0

  Reference


[1] Chae HS et al. (2013) Use of a novel Escherichia coli-leuconostoc shuttle vector for metabolic engineering of Leuconostoc citreum to overproduce D-lactate. Appl Environ Microbiol. 79(5):1428-35. [PMID:23241984]


Host bacterium


ID   119 GenBank   JN106352
Plasmid name   pMBLT00 Incompatibility group   -
Plasmid size   20721 bp Coordinate of oriT [Strand]   17020..17039 [-]
Host baterium   UNVERIFIED: Leuconostoc mesenteroides subsp. mesenteroides strain KCTC 13302

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -