Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100121
Name   oriT_2s-pEI2 in_silico
Organism   Edwardsiella ictaluri
Sequence Completeness      incomplete
NCBI accession of oriT (coordinates [strand])   NC_020295 (1867..1888 [+], 22 nt)
oriT length   22 nt
IRs (inverted repeats)     _
Location of nic site      18..19
Conserved sequence flanking the
  nic site    		  CTGG|CTTA
Note   ColE1 superfamily

  oriT sequence  


Download         Length: 22 nt

>oriT_2s-pEI2
GCACTCTGTGTATGCTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Rogge ML et al. (2013) Comparison of Vietnamese and US isolates of Edwardsiella ictaluri. Dis Aquat Organ. 106(1):17-29. [PMID:24062549]


Relaxase

ID   116 GenBank   YP_007459738
Name   MobA_2s-pEI2 insolico UniProt ID   M1L0K9
Length   357 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 357 a.a.        Molecular weight: 40988.91 Da        Isoelectric Point: 10.2148

>YP_007459738.1 MobA (plasmid) [Edwardsiella ictaluri]
MTSFEKALLPGLDADQYACLWVEHKDKGRLELNFVVPNIELTSGKRLQPYFDRADRPRIDAWKTGMNASL
SLLDPNDPMKKRELVTPRNLPPIKQEAARVITDSLLRLAELRDDKRSQYVVQSLEHAGFTVCRQTKSSIS
IADPDGGRNIRLKGMIYEQNFRFGPELRGEIEAASERYRKTSSDRTRDARNVYQRCFRQKRDDNQRRYKR
PESSYTGLTVKNMALDGPQPDRHPDSLLRRDLATRRDDHPELADHQRAERHAPAARSQGWENSNEHMRRQ
ETPVREDRSGCRHVWGHPEGRLSVEDTGGVLSDDRARTAAFERIRRIADAARRATQRIQNLINPNLGNGA
AFSKQGS

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(4-54)


  Protein structure


Source ID Structure
AlphaFold DB M1L0K9

  Reference


[1] Rogge ML et al. (2013) Comparison of Vietnamese and US isolates of Edwardsiella ictaluri. Dis Aquat Organ. 106(1):17-29. [PMID:24062549]


Auxiliary protein

ID   174 GenBank   YP_007459741
Name   MobC_2s-pEI2 insolico UniProt ID   M1LH35
Length   111 a.a. PDB ID   _
Note   Bacterial mobilization protein (MobC)

  Auxiliary protein sequence


Download         Length: 111 a.a.        Molecular weight: 12548.44 Da        Isoelectric Point: 10.7885

>YP_007459741.1 MobC (plasmid) [Edwardsiella ictaluri]
MSVTRTKIIKIRATDDEYAELVARSTKPKLAEWMRDTCLGAETRSTKSAKTPRIDPALLRQLSGLGNNLN
QIARAINSHEWKPIDRIQIVAALTTIQRELARLKAENSHDR

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(59-103)


  Protein structure


Source ID Structure
AlphaFold DB M1LH35

  Reference


[1] Rogge ML et al. (2013) Comparison of Vietnamese and US isolates of Edwardsiella ictaluri. Dis Aquat Organ. 106(1):17-29. [PMID:24062549]


Host bacterium

ID   116 GenBank   NC_020295
Plasmid name   2s-pEI2 Incompatibility group   -
Plasmid size   9103 bp Coordinate of oriT [Strand]   1867..1888 [+]
Host baterium   Edwardsiella ictaluri

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -