Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100119 |
| Name | oriT_pSF301-2  |
| Organism | Shigella flexneri |
| Sequence Completeness | core |
| NCBI accession of oriT (coordinates [strand]) | NC_019249 (916..948 [-], 33 nt) |
| oriT length | 33 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | 25..26 |
| Conserved sequence flanking the nic site |
CTGG|CTTA |
| Note | ColE1 superfamily |
oriT sequence
Download Length: 33 nt
>oriT_pSF301-2
GTAGCGATAACGGAGTGTATACTGGCTTAATTA
GTAGCGATAACGGAGTGTATACTGGCTTAATTA
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Auxiliary protein
| ID | 172 | GenBank | YP_006961078 |
| Name | TraJ_pSF301-2 |
UniProt ID | F6MFV8 |
| Length | 99 a.a. | PDB ID | _ |
| Note | putative plasmid mobilization protein | ||
Auxiliary protein sequence
Download Length: 99 a.a. Molecular weight: 10891.40 Da Isoelectric Point: 9.2047
>YP_006961078.1 putative plasmid mobilization protein (plasmid) [Shigella flexneri]
MLFWSSSASSCSRLHMXACSSASRASSFSSSVRLWLLIHRAIFSAVCCYLFTFRCSPSVPGVGGGDPEQV
VIVRRCGRRYYNCTSCPVSLGRIMAQHIN
MLFWSSSASSCSRLHMXACSSASRASSFSSSVRLWLLIHRAIFSAVCCYLFTFRCSPSVPGVGGGDPEQV
VIVRRCGRRYYNCTSCPVSLGRIMAQHIN
Protein domains
No domain identified.
Protein structure
No available structure.
Host bacterium
| ID | 114 | GenBank | NC_019249 |
| Plasmid name | pSF301-2 | Incompatibility group | ColRNAI |
| Plasmid size | 3178 bp | Coordinate of oriT [Strand] | 916..948 [-] |
| Host baterium | Shigella flexneri |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |