Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100114
Name   oriT_pA172 in_silico
Organism   Salmonella enterica subsp. enterica serovar Newport
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_010259 (7094..7311 [-], 218 nt)
oriT length   218 nt
IRs (inverted repeats)      46..53, 57..64  (TTCGGGGC..GCCCTGAA)
Location of nic site      97..98
Conserved sequence flanking the
  nic site  
 
 CTGG|CTAA
Note   ColE1 superfamily

  oriT sequence  


Download         Length: 218 nt

>oriT_pA172
GATGGCATGGGGTGATATCCAGTAGCGGAGAGGTTGTTAGCGGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTAAATATGTTACGGCGGAGTGGTGATTTATGAAAGTGCTTCATGTGACAAGGGAAAAAATGCGGCTACCGGGCGTAAGTGCAACATGCAGGTAAGGATGAAATGACGCCTCCTCGCTCAC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Zioga A et al. (2009) CMY-31 and CMY-36 cephalosporinases encoded by ColE1-like plasmids. Antimicrob Agents Chemother. 53(3):1256-9. [PMID:19104021]


Relaxase


ID   109 GenBank   YP_001649325
Name   MobB_pA172 insolico UniProt ID   B0FJX3
Length   156 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 156 a.a.        Molecular weight: 17556.39 Da        Isoelectric Point: 9.3491

>YP_001649325.1 relaxase (plasmid) [Salmonella enterica subsp. enterica serovar Newport]
MQQAIRMRIEADSASGKMTETVRQSVNAALTQVEKELKQTGLEQQKPATDAFNQAAGTAKAMIHEMRREM
SRYTWKSAIYIAMTMIAVMGGCLWGMYYFIDSGYARVAEMQHMEAVWQKKAPLADIKTCDGNPCVKVDIS
RTFGDKKDTYLIIKGK

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB B0FJX3

  Reference


[1] Zioga A et al. (2009) CMY-31 and CMY-36 cephalosporinases encoded by ColE1-like plasmids. Antimicrob Agents Chemother. 53(3):1256-9. [PMID:19104021]


Host bacterium


ID   109 GenBank   NC_010259
Plasmid name   pA172 Incompatibility group   -
Plasmid size   8197 bp Coordinate of oriT [Strand]   7094..7311 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Newport

Cargo genes


Drug resistance gene   CMY-31 cephalosporinase (blaCMY-type gene)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -