Detailed information of oriT

oriT


The information of the oriT region


Loading, please wait
oriTDB ID   100109
Name   oriT_pST12 in_silico
Organism   Salmonella enterica subsp. enterica serovar Derby str. T12
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_022376 (5989..6230 [-], 242 nt)
oriT length   242 nt
IRs (inverted repeats)      22..29, 33..40  (GTCGGGGC..GCCCTGAC)
Location of nic site      94..95
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   ColE1 superfamily

  oriT sequence  


Download         Length: 242 nt

>oriT_pST12
GCTCCGTATCTGACATGGGGTGTCGGGGCGAAGCCCTGACCAGGGTAATTGTAATAGCGTGCATGTATGCGCGGTATAACAATTGCACATCCTGTCCTGTCAGCAAGCTCGAATTACCGACAAAGGCACGGCAGTTTTTTGGCAGTGACAGTATTGTCAGGCAGAAATACCCGTCAAAGCGTCAGACGGCAGAATACCGGCGGTAAAACAGTCGAAAAGTGGTACGCGATATAATCACACAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Vignoli R et al. (2006) New TEM-Derived Extended-Spectrum 尾-Lactamase and Its Genomic Context in Plasmids from Salmonella enterica Serovar Derby Isolates from Uruguay. Antimicrob Agents Chemother. 50(2):781-4. [PMID:16436745]


Relaxase


ID   104 GenBank   YP_008574978
Name   MobA_pST12 insolico UniProt ID   T2MZH7
Length   145 a.a. PDB ID   
Note   plasmid mobilization protein

  Relaxase protein sequence


Download         Length: 145 a.a.        Molecular weight: 16419.13 Da        Isoelectric Point: 10.6379

>YP_008574978.1 plasmid mobilization protein (plasmid) [Salmonella enterica subsp. enterica serovar Derby str. T12]
MLTGQDVQLLYRAYMHAITITLVRASPRHPMSDTEPCFMTKRSGSNTRRRAISRPVRLTAEEDQEIRKRA
AECGKTVSGFLRAAALGKKVNSLTDDRVLKEVMRLGALQKKLFIDGKRVGDREYAEVLIAITEYHRALLS
RLMAD

  Protein domains



No domain identified.



  Protein structure



No available structure.



  Reference


[1] Vignoli R et al. (2006) New TEM-Derived Extended-Spectrum 尾-Lactamase and Its Genomic Context in Plasmids from Salmonella enterica Serovar Derby Isolates from Uruguay. Antimicrob Agents Chemother. 50(2):781-4. [PMID:16436745]


Host bacterium


ID   104 GenBank   NC_022376
Plasmid name   pST12 Incompatibility group   ColRNAI
Plasmid size   8275 bp Coordinate of oriT [Strand]   5989..6230 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Derby str. T12

Cargo genes


Drug resistance gene   blaTEM-144
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -