Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100092
Name   oriT_pSU233 experimental
Organism   Escherichia coli
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   X55896 (105..383 [-], 279 nt)
oriT length   279 nt
IRs (inverted repeats)      220..227, 230..237  (GCAAAAAC..GTTTTTGC)
Location of nic site      246..247
Conserved sequence flanking the
  nic site  
 
 GTGGGGTGT|GG
Note   _

  oriT sequence  


Download         Length: 279 nt

>oriT_pSU233
CGCTAGCAGCGCCCCTGACGGTATCCTATAAAAAAACACACCGCGCCGCTAGCAGCACCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAGCGGTGTCGGCGCGTTGCTGTAGCTGCGTTAACGACGCTGCTTTAAATAAATCAGATTTAAACAATATAAATCCACAAATACAACTCNATGATATTAAAGATAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Salazar L et al. (1992) Characterization and nucleotide sequence of the oriT-traM-finP region of the IncFVII plasmid pSU233. Mol Gen Genet . 234(3):442-8. [PMID:1406590]


Auxiliary protein


ID   126 GenBank   CAA39383
Name   TraM_pSU233 insolico UniProt ID   P33787
Length   127 a.a. PDB ID   _
Note   _

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14525.54 Da        Isoelectric Point: 4.8662

>CAA39383.1 traM protein (plasmid) [Escherichia coli]
MAKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVYEAQMERKESAFNQAEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSVEMERFFPKNDDE

  Protein domains


Predicted by InterproScan.

(1-126)


  Protein structure


Source ID Structure
AlphaFold DB P33787

  Reference


[1] Salazar L et al. (1992) Characterization and nucleotide sequence of the oriT-traM-finP region of the IncFVII plasmid pSU233. Mol Gen Genet . 234(3):442-8. [PMID:1406590]


Host bacterium


ID   87 GenBank   X55896
Plasmid name   pSU233 Incompatibility group   IncFVII
Plasmid size   1264 bp Coordinate of oriT [Strand]   105..383 [-]
Host baterium   Escherichia coli

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -