Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100091
Name   oriT_pIE1120 in_silico
Organism   Uncultured bacterium
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   AF070999 (203..290 [+], 88 nt)
oriT length   88 nt
IRs (inverted repeats)      1..10, 14..23  (CCAGTTTCTC..GAGAAACCGG)
Location of nic site      31..32
Conserved sequence flanking the
  nic site    		  TAAGTGCG|CCCT
Note   similar to the oriT of IncQ plasmid RSF101

  oriT sequence  


Download         Length: 88 nt

>oriT_pIE1120
CCAGTTTCTCGAAGAGAAACCGGTAAGTGCGCCCTCCCCTACAAAGTAGGGTCGGGATTGCCGCCGCTGTGCCTCCATGATAGCCTAC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Smalla K et al. (2000) Exogenous isolation of antibiotic resistance plasmids from piggery manure slurries reveals a high prevalence and diversity of IncQ-like plasmids. Appl Environ Microbiol. 66(11):4854-62. [PMID:11055935]


Relaxase

ID   86 GenBank   AAC72343
Name   MobA_pIE1120 insolico UniProt ID   O88171
Length   40 a.a. PDB ID   
Note   Conjugal transfer relaxase TraA; partial sequence

  Relaxase protein sequence


Download         Length: 40 a.a.        Molecular weight: 4446.00 Da        Isoelectric Point: 9.6600

>AAC72343.1 mobilization protein MobA, partial (plasmid) [IncQ plasmid pIE1120]
MAIYHLTAKTGSRSGGQSARAKADYIQREGKYARDMDEVL

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB O88171

  Reference


[1] Smalla K et al. (2000) Exogenous isolation of antibiotic resistance plasmids from piggery manure slurries reveals a high prevalence and diversity of IncQ-like plasmids. Appl Environ Microbiol. 66(11):4854-62. [PMID:11055935]


Auxiliary protein

ID   125 GenBank   AAC72342
Name   MobC_pIE1120 insolico UniProt ID   Q7BT86
Length   94 a.a. PDB ID   _
Note   mobilization protein MobC

  Auxiliary protein sequence


Download         Length: 94 a.a.        Molecular weight: 10883.41 Da        Isoelectric Point: 10.4580

>AAC72342.1 mobilization protein MobC (plasmid) [IncQ plasmid pIE1120]
MVKGSNKAADRLAKLEEQRARINAEIQRVRAREQQQERKNETRRKVLVGAMILAKVNSSEWPEDRLMAAM
DAYLERDHDRALFGLPPRQKDEPG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB Q7BT86


Host bacterium

ID   86 GenBank   AF070999
Plasmid name   pIE1120 Incompatibility group   IncQ1
Plasmid size   3306 bp Coordinate of oriT [Strand]   203..290 [+]
Host baterium   Uncultured bacterium

Cargo genes

Drug resistance gene   resistance to tetracycline and streptomycin
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -