Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100090
Name   oriT_pGO1 experimental
Organism   Staphylococcus aureus
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_012547 (10191..10226 [+], 36 nt)
oriT length   36 nt
IRs (inverted repeats)      4..10, 14..20  (GCGAACG..CGTTCGC)
Location of nic site      31..32
Conserved sequence flanking the
  nic site  
 
 TAAGTGCGCC|CT
Note   _

  oriT sequence  


Download         Length: 36 nt

>oriT_pGO1
CACGCGAACGGAACGTTCGCATAAGTGCGCCCTTAC

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Climo MW et al. (1996) Identification and characterization of the origin of conjugative transfer (oriT) and a gene (nes) encoding a single-stranded endonuclease on the Staphylococcal plasmid pGO1. J Bacteriol. 178(16):4975-83. [PMID:8759863]


Relaxase


ID   85 GenBank   YP_002790904
Name   Nes_pGO1 insolico UniProt ID   O87361
Length   665 a.a. PDB ID   
Note   oriT relaxase Nes

  Relaxase protein sequence


Download         Length: 665 a.a.        Molecular weight: 78908.86 Da        Isoelectric Point: 5.3910

>YP_002790904.1 oriT relaxase Nes (plasmid) [Staphylococcus aureus]
MAMYHFQNKFVSKANGQSATAKSAYNSASRIKDFKENEFKDYSNKQCDYSEILLPNNADDKFKDREYLWN
KVHDVENRKNSQVAREIIIGLPNEFDPNSNIELAKEFAESLSNEGMIVDLNIHKINEENPHAHLLCTLRG
LDKNNEFEPKRKGNDYIRDWNTKEKHNEWRKRWENVQNKHLEKNGFSVRVSADSYKNQNIDLEPTKKEGW
KARKFEDETGKKSSISKHNESIKKRNQQKIDKMFNEVDDMKSHKLNAFSYMNKSDSTTLKNMAKDLKIYV
TPINMYKENERLYDLKQKTSLITDDEDRLNKIEDIEDRQKKLESINEVFEKQAGIFFDKNYPDQSLNYSD
DEKIFITRTILNDRDVLPANNELEDIVKEKRIKEAQISLNTVLGNRDISLESIEKESNFFADKLSNILEK
NNLSFDDVLENKHEGMEDSLKIDYYTNKLEVFRNAENILEDYYDVQIKELFTDDEDYKAFNEVTDIKEKQ
QLIDFKTYHGTENTIEMLETGNFIPKYSDEDRKYITEQVKLLQEKEFKPNKNQHDKFVFGAIQKKLLSEY
DFDYSDNNDLKHLYQESNEVGDEISKDNIEEFYEGNDILVDKETYNNYNRKQQAYGLINAGLDSMIFNFN
EIFRERMPKYINHQYKGKNHSKQRHELKNKRGMHL

  Protein domains


Predicted by InterproScan.

(17-216)


  Protein structure


Source ID Structure
PDB 4HTE
AlphaFold DB O87361

  Reference


[1] Climo MW et al. (1996) Identification and characterization of the origin of conjugative transfer (oriT) and a gene (nes) encoding a single-stranded endonuclease on the Staphylococcal plasmid pGO1. J Bacteriol. 178(16):4975-83. [PMID:8759863]


T4CP


ID   85 GenBank   YP_002790929
Name   TrsK_pGO1 insolico UniProt ID   Q07713
Length   546 a.a. PDB ID   _
Note   similar to transfer-associated proteins of Gram-negative conjugation systems such as TraD from the F plasmid

  T4CP protein sequence


Download         Length: 546 a.a.        Molecular weight: 62672.60 Da        Isoelectric Point: 7.6569

>YP_002790929.1 TrsK protein (plasmid) [Staphylococcus aureus]
MTTLLGELESKATSINKKNLVIQDFDTKCPNRNIFVVGGPGSYKSAGYVIPNVIVKNQQSIVVTDPSGEV
YEKTSNIKRMQGFDVRVVNFKNFLASDRQNFFDYIDKDSDCSIVAELIIKSAGDSKINKDVWYKASVGLL
NSLLLYAKYEFEPEKRTIGNIIKFIQNNKPNQDEEGSVELDKRFNELSKDHPARESYEFGFAVSEGRTRA
SIILTFVADLRNYIDNEIRSYTSDSDFDLRDVGLRKTIIYVMLPVLGNTVQSLSSLFFSQMFQQLYRLGD
ENGARLPVPVDFLLDEWPNIGAIPDYEETLATCRKYGISITTIVQSISQAVDKYNKDKANAIIGNHAVIL
CLGNVNNDTAKYIKEELGNATVEFETSSEGSSSGKDSRSKSSNKNVSYTGRALLNEDEISNMQQDKAILI
TKNRNPKIIKKLAYFKMFPNLTETYIAPQNEYKRKKNQSMIDKHNRLREEWDKKQEKNKQQKLEEYKEEQ
RQKELEKEQQPQEEQQNEKVKESKDKNDQEDKKDEQQKINDSKKAFYEKLKQKQAK

  Protein domains


Predicted by InterproScan.

(3-462)

  Protein structure


Source ID Structure
AlphaFold DB Q07713

  Reference


[1] Gomis-Rüth FX et al. (2002) Conjugative plasmid protein TrwB, an integral membrane type IV secretion system coupling protein. Detailed structural features and mapping of the active site cleft. J Biol Chem. 277(9):7556-66. [PMID:11748238]


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 25492..36713

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PGO1_RS00115 (PGO1_p20) 21240..21644 - 405 WP_001242578 bleomycin binding protein -
PGO1_RS00120 (PGO1_p21) 21861..22631 - 771 WP_001795128 aminoglycoside O-nucleotidyltransferase ANT(4')-Ia -
PGO1_RS00125 22791..22937 - 147 WP_001817822 hypothetical protein -
PGO1_RS00130 (PGO1_p22) 22981..23655 + 675 WP_001106019 IS6-like element IS257 family transposase -
PGO1_RS00135 (PGO1_p23) 23764..23952 - 189 WP_001063224 hypothetical protein -
PGO1_RS00140 (PGO1_p24) 24124..25098 + 975 WP_000368849 conjugative transfer protein TrsA -
PGO1_RS00145 (PGO1_p25) 25115..25432 + 318 WP_000591622 CagC family type IV secretion system protein -
PGO1_RS00150 (PGO1_p26) 25492..25899 + 408 WP_000110157 hypothetical protein trsC
PGO1_RS00155 (PGO1_p27) 25886..26569 + 684 WP_000979860 TrsD/TraD family conjugative transfer protein trsD
PGO1_RS00160 (PGO1_p28) 26584..28602 + 2019 WP_001795400 DUF87 domain-containing protein virb4
PGO1_RS00165 (PGO1_p29) 28614..29894 + 1281 WP_000702361 membrane protein trsF
PGO1_RS00170 (PGO1_p30) 29912..30988 + 1077 WP_000269385 CHAP domain-containing protein trsG
PGO1_RS00175 (PGO1_p31) 30998..31483 + 486 WP_000735569 TrsH/TraH family protein -
PGO1_RS00180 (PGO1_p32) 31499..33601 + 2103 WP_001094109 DNA topoisomerase III -
PGO1_RS00185 (PGO1_p33) 33617..34081 + 465 WP_000715273 hypothetical protein trsJ
PGO1_RS00190 (PGO1_p34) 34078..35718 + 1641 WP_000209436 VirD4-like conjugal transfer protein, CD1115 family -
PGO1_RS00195 (PGO1_p35) 35796..36713 + 918 WP_000383804 conjugal transfer protein TrbL family protein trsL
PGO1_RS00200 (PGO1_p36) 36730..37122 + 393 WP_000608970 single-stranded DNA-binding protein -
PGO1_RS00205 (PGO1_p37) 37179..37346 + 168 WP_000869301 hypothetical protein -
PGO1_RS00210 (PGO1_p38) 37384..38058 + 675 WP_001105984 IS6-like element IS257 family transposase -
PGO1_RS00215 (PGO1_p39) 38162..39085 + 924 WP_001579520 protein rep -
PGO1_RS00220 (PGO1_p40) 39618..39839 - 222 WP_000799767 hypothetical protein -
PGO1_RS00225 (PGO1_p41) 40057..40380 - 324 WP_001146389 quaternary ammonium compound efflux SMR transporter QacC -
PGO1_RS00230 40688..40918 + 231 WP_000956386 hypothetical protein -
PGO1_RS00235 (PGO1_p42) 40948..41622 + 675 WP_001105984 IS6-like element IS257 family transposase -


Host bacterium


ID   85 GenBank   NC_012547
Plasmid name   pGO1 Incompatibility group   Inc18
Plasmid size   54000 bp Coordinate of oriT [Strand]   10191..10226 [+]
Host baterium   Staphylococcus aureus

Cargo genes


Drug resistance gene   aminoglycoside resistance; resistance to trimethoprim,bleomycin and quaternary ammonium compounds
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA21