Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100087 |
| Name | oriT_pIP1629 |
| Organism | Staphylococcus epidermidis |
| Sequence Completeness | intact |
| NCBI accession of oriT (coordinates [strand]) | AF045240 (395..510 [+], 116 nt) |
| oriT length | 116 nt |
| IRs (inverted repeats) | IR1: 1..7, 11..17 (TTGGGGATATTCCCCAA) IR2: 30..37, 42..50 (GCTACCAC..GTGGCTAGC) IR3: 90..101, 105..116 (ATTTTACTTTAT..ATAAAGTAAAAT) |
| Location of nic site | 64..65 |
| Conserved sequence flanking the nic site |
TGCTTG|CCA |
| Note | Small Staphylococcal Plasmid, ColE1 superfamily |
oriT sequence
Download Length: 116 nt
TTGGGGATATTCCCCAACAAGCAGGCGTCGCTACCACGTGAGTGGCTAGCAAAGCCAATGCTTGCCAAACCACTTAACGCCTTTCTTACATTTTACTTTATAGGATAAAGTAAAAT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Reference
[1] Smith MC et al. (2004) An accessory protein is required for relaxosome formation by small Staphylococcal plasmids. J Bacteriol. 186(11):3363-73. [PMID:15150221]
[2] Jamie A Caryl et al. (2004) Reconstitution of a staphylococcal plasmid-protein relaxation complex in vitro. Journal of bacteriology. 186(11):3374-83. [PMID:15150221]
Relaxase
| ID | 82 | GenBank | AAD02378 |
| Name | MobA1_pIP1629 |
UniProt ID | Q9Z361 |
| Length | 336 a.a. | PDB ID | |
| Note | relaxase | ||
Relaxase protein sequence
Download Length: 336 a.a. Molecular weight: 38491.54 Da Isoelectric Point: 7.8436
MATTKLSATKSTSRAINYAEKRAVEKSGLNCDVDYAKSSFKASRELYGKTDGNQGHVIIQSFKPGEVTPE
QCNQLGLALAEKLAPNHQVAVYTHADTDHVHNHIVMNSIDLETGKKFNNNKQALRNVRNFNDEVCMEHGL
SVPDKDTARLRYTQTEKAIADPNTKSTAQYSWKDEIREAIDQSQATNMNEFKDHLNQHGIEIERVTPKSI
TYRHLVEDKKVRGRKLGEDYNKGGIEDGFERQIQRRRQQERDSDIECQPKRPISSRDEATKRDTGITQAD
WDQFAQDTNELERSRQAAESARLADEKARRDREERERAKKASRRIINNDRDHGLEL
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9Z361 |
Reference
[1] Smith MC et al. (2004) An accessory protein is required for relaxosome formation by small Staphylococcal plasmids. J Bacteriol. 186(11):3363-73. [PMID:15150221]
[2] Jamie A Caryl et al. (2004) Reconstitution of a staphylococcal plasmid-protein relaxation complex in vitro. Journal of bacteriology. 186(11):3374-83. [PMID:15150221]
Auxiliary protein
| ID | 119 | GenBank | AAD02379 |
| Name | MobB1_pIP1629 |
UniProt ID | Q9Z380 |
| Length | 269 a.a. | PDB ID | _ |
| Note | mobilization protein | ||
Auxiliary protein sequence
Download Length: 269 a.a. Molecular weight: 31463.91 Da Isoelectric Point: 7.5569
MALKDKFNDGDNKNETQTSNASQNDQFQVVMKQLNEIQASLKQIGTNSPKTQMSLSVADKLQNQQDLLMK
RLEEIEKRENERKKRHDELLTTIEITASNFNQATEITQKRFISVAKHYIERINNDNLKQDFQTAIQEELK
DVKTDTHKAIEQLQTNQAELRQANNDYKATMDERIKHNDTAMKQYDQAFHRLTQGITAMFFIVALVMIAF
LALSPLGDWLGVQHFYEWLNYVLKTGHSVWRYLIVIFYLVPYVFFGMLIYAILSAYKRI
Protein domains
No domain identified.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9Z380 |
Reference
[1] Smith MC et al. (2004) An accessory protein is required for relaxosome formation by small Staphylococcal plasmids. J Bacteriol. 186(11):3363-73. [PMID:15150221]
[2] Jamie A Caryl et al. (2004) Reconstitution of a staphylococcal plasmid-protein relaxation complex in vitro. Journal of bacteriology. 186(11):3374-83. [PMID:15150221]
| ID | 120 | GenBank | AAD02376 |
| Name | MobC1_pIP1629 |
UniProt ID | Q9R3U7 |
| Length | 127 a.a. | PDB ID | _ |
| Note | Bacterial mobilisation protein (MobC); pfam05713 | ||
Auxiliary protein sequence
Download Length: 127 a.a. Molecular weight: 14529.43 Da Isoelectric Point: 10.0070
MSEQNTFVASDETVGRNRKPNRKEPKQISFRVSESEYLKLQQSAETLNMSVPAFVKKKAQGARLVAPKLD
QATRQSVAKDLSMLGANANQIAKYCNQHQHEAPNYEALERNISELRERLDEIWKKLN
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9R3U7 |
Reference
[1] Smith MC et al. (2004) An accessory protein is required for relaxosome formation by small Staphylococcal plasmids. J Bacteriol. 186(11):3363-73. [PMID:15150221]
[2] Jamie A Caryl et al. (2004) Reconstitution of a staphylococcal plasmid-protein relaxation complex in vitro. Journal of bacteriology. 186(11):3374-83. [PMID:15150221]
Host bacterium
| ID | 82 | GenBank | AF045240 |
| Plasmid name | pIP1629 | Incompatibility group | - |
| Plasmid size | 5993 bp | Coordinate of oriT [Strand] | 395..510 [+] |
| Host baterium | Staphylococcus epidermidis |
Cargo genes
| Drug resistance gene | resistance to streptogramin A |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |