Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100083
Name   oriT_pMAB01 experimental
Organism   Mycobacterium abscessus subsp. bolletii INCQS 00594
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   CP003376 (32885..33188 [+], 304 nt)
oriT length   304 nt
IRs (inverted repeats)      55..72, 75..92  (TGAAGATAGATAACCGGC..GCCGGTTAGCTAACTTCA)
Location of nic site      101..102
Conserved sequence flanking the
  nic site    		  CATCCTG|C
Note   similar to oriT of the IncP-1beta multiresistance plasmid pB10

  oriT sequence  


Download         Length: 304 nt

>oriT_pMAB01
TGCCTCGCAGAGCAGGATGACCCGTTGAGCGCCCCCGGCGCGAATAAGGGACAGTGAAGATAGATAACCGGCTCGCCGGTTAGCTAACTTCACACATCCTGCCCGCCTTACGGCGTTAATAACACCAAGGAAAGTCTACACCAGCCATTACGATTTATCCGCAACTATCGCGCTATCAGGCCGCAAAAGCAGCAACGGATATAGCGAAAACCGCCACAATGGCCCATAATGCCGCTATCGAAGCGTGCCAATGCACGCCGATAGCGGACTTTTTGCGTTTCCGTAGCGCCGCTTAGTAGCGTTA

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Leão SC et al. (2013) The detection and sequencing of a broad-host-range conjugative IncP-1尾 plasmid in an epidemic strain of Mycobacterium abscessus subsp. Bolletii. PLoS One. 8(4):e60746. [PMID:23565273]


Relaxase

ID   78 GenBank   AGJ01256
Name   TraI_pMAB01 insolico UniProt ID   _
Length   746 a.a. PDB ID   
Note   conjugal transfer relaxase TraI; Provisional

  Relaxase protein sequence


Download         Length: 746 a.a.        Molecular weight: 82038.71 Da        Isoelectric Point: 10.7900

>AGJ01256.1 TraI (plasmid) [Mycobacteroides abscessus subsp. bolletii INCQS 00594]
MIAKHVPMRSLGKSDFAGLANYITDAQSKDHRLGHVQATNCEAGSIQDAITEVLATQHTNTRAKGDKTYH
LIVSFRAGEQPSADTLRAIEERICVGLGYGEHQRISAVHNDTDNLHIHIAINKIHPTRHTMHEPYYPHRA
LAELCTALERDYGLERDNHEPRKRGAEGRAADMERHAGVESLVGWIKRECLDEIKGAQSWQELHQVMRDN
GMELRVRANGLVFEAGDGTMVKASTVARDLSKPSLEARLGPFEASPERQAQTTAKRQYRKDPIRLRVNTV
ELYAKYKAEQQSLTTARAQALERARHRKDRLIEAAKRSNRLRRATIKVVGEGRANKKLLYAQASKALRSE
LQAINKQFQQERTALYAEHSRRTWADWLKKEAQHGGADALAALRAREAAQGLKGNTIRGEGQAKPGHAPA
VDNITKKGTIIFRAGMSAVRDDGDRLQVSREATREGLQEALRLAMQRYGNRITVNGTVEFKAQMIRAAVD
SQLPITFTDPALESRRQALLNKENTHERTERPEHRGRTGRGAGGPGQRPAADQHATGAAAVARAGDGRPA
AGRGDRADAGLHAATVHRKPDVGRLGRKPPPQSQHRLRALSELGVVRIAGGSEVLLPRDVPRHVEQQGTQ
PDHALRRGISRPGTGVGQTPPGVAAADKYIAEREAKRLKGFDIPKHSRYTAGDGALTFQGTRTIEGQALA
LLKRGDEVMVMPIDQATARRLTRIAVGDAVSITAKGSIKTSKGRSR

  Protein domains


Predicted by InterproScan.

Large polyvalent protein-associated domain 7 (LPD7)

(422-508)

Relaxase/Mobilisation nuclease domain (Relaxase)

(12-251)


  Protein structure



No available structure.



  Reference


[1] Leão SC et al. (2013) The detection and sequencing of a broad-host-range conjugative IncP-1尾 plasmid in an epidemic strain of Mycobacterium abscessus subsp. Bolletii. PLoS One. 8(4):e60746. [PMID:23565273]


Auxiliary protein

ID   112 GenBank   AGJ01257
Name   TraH_pMAB01 insolico UniProt ID   _
Length   130 a.a. PDB ID   _
Note   _

  Auxiliary protein sequence


Download         Length: 130 a.a.        Molecular weight: 13936.41 Da        Isoelectric Point: 3.9776

>AGJ01257.1 TraH (plasmid) [Mycobacteroides abscessus subsp. bolletii INCQS 00594]
MSEPKDQSIEDELDAALAALDSGPLPTSTLPEPQPSPEQATAGQPPAEATAPTPAFTPPPSTGSPTLDAL
EENRRPKASTVCEHCPNSVWFASPAEVKCYCRVMFLVTWSSKEPNQITHCDGEFLGQEQE

  Protein domains



No domain identified.



  Protein structure



No available structure.



  Reference


[1] Leão SC et al. (2013) The detection and sequencing of a broad-host-range conjugative IncP-1尾 plasmid in an epidemic strain of Mycobacterium abscessus subsp. Bolletii. PLoS One. 8(4):e60746. [PMID:23565273]

ID   113 GenBank   AGJ01258
Name   TraJ_pMAB01 insolico UniProt ID   _
Length   124 a.a. PDB ID   _
Note   conjugal transfer relaxosome component TraJ

  Auxiliary protein sequence


Download         Length: 124 a.a.        Molecular weight: 14206.27 Da        Isoelectric Point: 8.5329

>AGJ01258.1 TraJ (plasmid) [Mycobacteroides abscessus subsp. bolletii INCQS 00594]
MENDEKEHGRRRRQHLRVPVFPEEKDEIEANAKRAGVSVARYLRDVGQGYQIKGVMDYQHVRELVRVNGD
LGRLGGLLKLWLTDDVRTLQFGEATILALLGRIEATQDEMSRIMKAVVQPRAEP

  Protein domains



No domain identified.



  Protein structure



No available structure.



  Reference


[1] Leão SC et al. (2013) The detection and sequencing of a broad-host-range conjugative IncP-1尾 plasmid in an epidemic strain of Mycobacterium abscessus subsp. Bolletii. PLoS One. 8(4):e60746. [PMID:23565273]

ID   114 GenBank   AGJ01259
Name   TraK_pMAB01 insolico UniProt ID   _
Length   132 a.a. PDB ID   _
Note   _

  Auxiliary protein sequence


Download         Length: 132 a.a.        Molecular weight: 14621.83 Da        Isoelectric Point: 9.9884

>AGJ01259.1 TraK (plasmid) [Mycobacteroides abscessus subsp. bolletii INCQS 00594]
MPKTYPEELAEWVKGREAKKPRQDKHVVAFLAVKSDVQAALDAGYAMKTIWEHMKETGRLRCRYETFTQH
VKRYIKAAPVASPPPPATPPDSQPKGAKPEPKAAPPASESKSEPPKIGGFTFDATPKKEDLL

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5338) (DUF5338)

(7-74)


  Protein structure



No available structure.



  Reference


[1] Leão SC et al. (2013) The detection and sequencing of a broad-host-range conjugative IncP-1尾 plasmid in an epidemic strain of Mycobacterium abscessus subsp. Bolletii. PLoS One. 8(4):e60746. [PMID:23565273]


T4CP

ID   78 GenBank   AGJ01255
Name   TraG_pMAB01 insolico UniProt ID   _
Length   637 a.a. PDB ID   _
Note   onjugal transfer coupling protein TraG

  T4CP protein sequence


Download         Length: 637 a.a.        Molecular weight: 69897.09 Da        Isoelectric Point: 8.2993

>AGJ01255.1 Conjugal transfer protein traG (plasmid) [Mycobacteroides abscessus subsp. bolletii INCQS 00594]
MKIKMNNAVGPQVRTAKPKPSKLLPVLGAASMVGGLQAATQFFAHTFAYHATLGPNVGHVYAPWSILHWT
YKWYSQYPDEIMKAGSMGMLVSTVGLLGVAVAKVVTSNSSKANEYLHGSARWAEKKDIQAAGLLPRERNV
LEIVTGKAAPTATGVYVGGWQDKDGNFFYLRHSGPEHVLTYAPTRSGKGVGLVVPTLLSWGASSVITDLK
GELWALTAGWRQKHAKNKVLRFEPASTSGGVCWNPLDEIRLGTEYEVGDVQNLATLIVDPDGKGLDSHWQ
KTAFALLVGVILHALYKAKDDGGTATLPSVDAMLADPNRDIGELWMEMATYGHVDGQNHHAIGSAARDMM
DRPEEEAGSVLSTAKSYLALYRDPVVARNVSRSDFRIKQLMHEDDPVSLYIVTQPNDKARLRPLVRVMVN
MIVRLLADKMDFEGGRPVAHYKHRLLMMLDEFPSLGKLEIMQESLAFVAGYGIKCYLICQDINQLKSRET
GYGHDESITSNCHVQNAYPPNRVETAEHLSRLTGQTTVVKEQITTSGRRTAAMLGQVSRTYQEVQRPLLT
PDECLRMPGPKKNAQGEIEEAGDMVIYVAGYPAIYGKQPLYFKDPVFSARAAIPAPKVSDRLRAVAQAET
EGEGITI

  Protein domains


Predicted by InterproScan.

Type IV secretory system Conjugative DNA transfer (T4SS-DNA_transf)

(121-620)

  Protein structure



No available structure.



  Reference


[1] Leão SC et al. (2013) The detection and sequencing of a broad-host-range conjugative IncP-1尾 plasmid in an epidemic strain of Mycobacterium abscessus subsp. Bolletii. PLoS One. 8(4):e60746. [PMID:23565273]


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 2395..13072

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
pMAB01_001 1..1221 - 1221 AGJ01225 Replication initiation protein -
pMAB01_002 1268..1609 - 342 AGJ01226 Single-stranded DNA-binding protein -
pMAB01_003 1723..2085 + 363 AGJ01227 Conjugal transfer protein TrbA -
pMAB01_004 2395..3357 + 963 AGJ01228 Conjugal transfer protein trbB virB11
pMAB01_005 3374..3838 + 465 AGJ01229 Conjugal transfer protein TrbC virB2
pMAB01_006 3842..4153 + 312 AGJ01230 Conjugal transfer protein TrbD virB3
pMAB01_007 4150..6708 + 2559 AGJ01231 Conjugal transfer protein TrbE virb4
pMAB01_008 6705..7487 + 783 AGJ01232 Conjugal transfer protein TrbF virB8
pMAB01_009 7484..8404 + 921 AGJ01233 Conjugal transfer protein TrbG virB9
pMAB01_010 8407..8895 + 489 AGJ01234 Conjugal transfer protein TrbH -
pMAB01_011 8900..10321 + 1422 AGJ01235 Conjugal transfer protein TrbI virB10
pMAB01_012 10342..11106 + 765 AGJ01236 Conjugal transfer protein TrbJ virB5
pMAB01_013 11116..11343 + 228 AGJ01237 Conjugal transfer entry exclusion protein TrbK -
pMAB01_014 11354..13072 + 1719 AGJ01238 Conjugal transfer protein TrbL virB6
pMAB01_015 13090..13677 + 588 AGJ01239 Conjugal transfer protein TrbM -
pMAB01_016 13691..14326 + 636 AGJ01240 Conjugal transfer protein TrbN -
pMAB01_017 14355..14621 + 267 AGJ01241 Conjugal transfer protein TrbO -
pMAB01_018 14621..15319 + 699 AGJ01242 Conjugal transfer protein TrbP -
pMAB01_019 15335..15766 + 432 AGJ01243 Outer membrane protein precursor -
pMAB01_020 16030..16530 - 501 AGJ01244 GCN5-like N-acetyltransferase -
pMAB01_021 16658..17497 - 840 AGJ01245 Dihydropteroate synthase type-1 -
pMAB01_022 17491..17838 - 348 AGJ01246 Ethidium bromide resistance protein -

Host bacterium

ID   78 GenBank   CP003376
Plasmid name   pMAB01 Incompatibility group   IncP1
Plasmid size   56267 bp Coordinate of oriT [Strand]   32885..33188 [+]
Host baterium   Mycobacterium abscessus subsp. bolletii INCQS 00594

Cargo genes

Drug resistance gene   streptomycin resistance genes (strA strB); aminoglycoside 6 N-acetyltransferase gene (aac(6-Ib)
Virulence gene   -
Metal resistance gene   merE, merD, merA, merP, merT, merR
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIF24