Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100080
Name   oriT_pBM02 in_silico
Organism   Lactococcus lactis subsp. cremoris strain P8-2-47
Sequence Completeness      incomplete
NCBI accession of oriT (coordinates [strand])   AY026767 (248..277 [+], 30 nt)
oriT length   30 nt
IRs (inverted repeats)      1..12, 19..30  (AAGTAAAGTATA..TATACTTTACTT)
Location of nic site      17..18
Conserved sequence flanking the
  nic site  
 
 TAGTGTG|CTAT
Note   homologous to that of plasmid pMV158

  oriT sequence  


Download         Length: 30 nt

>oriT_pBM02
AAGTAAAGTATAGTGTGCTATACTTTACTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Sánchez C et al. (2003) Sequence and analysis of pBM02, a novel RCR cryptic plasmid from Lactococcus lactis subsp cremoris P8-2-47. Plasmid. 49(2):118-29. [PMID:12726765]


Relaxase


ID   75 GenBank   AAK13009
Name   Mob_pBM02 insolico UniProt ID   Q939P5
Length   304 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 304 a.a.        Molecular weight: 35379.14 Da        Isoelectric Point: 6.6266

>AAK13009.1 Mob-like protein (plasmid) [Lactococcus cremoris]
MSMMVATMKKMKNGNLGGIQKHNQREFENHSNEDIDPERSDMNYDLVNDEKINYNEKVNQIIDEQRVGTR
AIRKDAVKVDEWIISSDREFFNNLDSEQTKEFFQSVVDYFSENFGKQNVAYANVHLDETTPHMHMGVVPM
KDGKLSSKTVFTREKLTEIQEQLPQYLNAKGFDIERGIEGSKSKHHDTSEYKKLKENITKEQFEDLSYKL
DQSEKRNIVYQDILENDFKVKTIEPREMKARLVLNDLERGIQPSNLDQAKEWLRNLKNAVGTKIDPSRLV
KGIDKLEKIIKVVFKVVKGMTLGL

  Protein domains


Predicted by InterproScan.

(1-193)


  Protein structure


Source ID Structure
AlphaFold DB Q939P5

  Reference


[1] Sánchez C et al. (2003) Sequence and analysis of pBM02, a novel RCR cryptic plasmid from Lactococcus lactis subsp cremoris P8-2-47. Plasmid. 49(2):118-29. [PMID:12726765]


Host bacterium


ID   75 GenBank   AY026767
Plasmid name   pBM02 Incompatibility group   -
Plasmid size   3854 bp Coordinate of oriT [Strand]   248..277 [+]
Host baterium   Lactococcus lactis subsp. cremoris strain P8-2-47

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -