Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100064
Name   oriT_pPDL2 in_silico
Organism   Sphingobium fuliginis ATCC 27551
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_019376 (35038..35082 [+], 45 nt)
oriT length   45 nt
IRs (inverted repeats)      24..34, 35..45  (AAGAAGAAAAG..CGCCGCCTCTT)
Location of nic site      9..10
Conserved sequence flanking the
  nic site  
 
 TATCCCG|C
Note   _

  oriT sequence  


Download         Length: 45 nt

>oriT_pPDL2
GCTATCCCGCGCCGCTGCTGAAGAAGAAGAAAAGCGCCGCCTCTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Pandeeti EV et al. (2012) Multiple mechanisms contribute to lateral transfer of an organophosphate degradation (opd) island in Sphingobium fuliginis ATCC 27551. G3 (Bethesda). 2(12):1541-54. [PMID:23275877]


Relaxase


ID   60 GenBank   YP_006965809
Name   RepB_pPDL2 insolico UniProt ID   K4I164
Length   303 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 303 a.a.        Molecular weight: 34450.02 Da        Isoelectric Point: 9.5732

>YP_006965809.1 Replication initiation protein (plasmid) [Sphingobium fuliginis ATCC 27551]
MNHATSPVNGGKAKVALDGDTALTLAQKGRGNPFDPANYGEIVKPGELVDIVELSPLTLADRRIYNLLIA
NAWERIGEPVIHRIPKSALKGTHQGNERIESSLLRLMGTIAIVTIRKGGKSFKRRVQLLGPSDESLEKDG
FLHYRIPEELIEILRNSEVYARLKTQVMYCFESKYALCLYEMIERRIGLEYKQSEEFTIAELRGLLNVPE
GKLERFADFNKYCLKVAQEEINKLCPFWVEFTPIKKGRKVERVSMMWLPKTMSGRRDAQNLIDQHSIVRR
AKLRGDIPEMPVLVDFSAPAAQR

  Protein domains


Predicted by InterproScan.

(54-253)


  Protein structure


Source ID Structure
AlphaFold DB K4I164

  Reference


[1] Pandeeti EV et al. (2012) Multiple mechanisms contribute to lateral transfer of an organophosphate degradation (opd) island in Sphingobium fuliginis ATCC 27551. G3 (Bethesda). 2(12):1541-54. [PMID:23275877]


Host bacterium


ID   60 GenBank   NC_019376
Plasmid name   pPDL2 Incompatibility group   IncP1
Plasmid size   37317 bp Coordinate of oriT [Strand]   35038..35082 [+]
Host baterium   Sphingobium fuliginis ATCC 27551

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   organophosphate degradation(opd gene cluster)
Symbiosis gene   -
Anti-CRISPR   -