Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100053
Name   oriT_pKLH80 in_silico
Organism   Psychrobacter maritimus
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   HF953351 (1..117 [-], 117 nt)
oriT length   117 nt
IRs (inverted repeats)      IR: 28..32, 41..45  (TTTTA..TAAAA)
  71..76, 80..85  (TTGGGG..CCCCAA)
  102..105, 112..115  (TAAG..CTTA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   _

  oriT sequence  


Download         Length: 117 nt

>oriT_pKLH80
TAAGCCAGCAGTCACAAGAGGGGGCTATTTTATGCTACGCTAAAAACATCCTATCCCTCTTGTGTGCTGGTTGGGGAGACCCCAAACCCCCTTCAATCTTTTAAGGTGCGTCTTATT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Petrova M et al. (2014) Genetic structure and biological properties of the first ancient multiresistance plasmid pKLH80 isolated from a permafrost bacterium. Microbiology. 160(Pt 10):2253-63. [PMID:25063046]


Relaxase

ID   51 GenBank   CCW43458
Name   MobA_pKLH80 insolico UniProt ID   N1NUY4
Length   388 a.a. PDB ID   
Note   relaxase/mobilization nuclease domain protein,MobA

  Relaxase protein sequence


Download         Length: 388 a.a.        Molecular weight: 44716.62 Da        Isoelectric Point: 9.5052

>CCW43458.1 relaxase/mobilization nuclease domain protein,MobA (plasmid) [Psychrobacter maritimus]
MIVKFSKHGKGKASGVLNYLLKEKGSDGVLVPRKHTKVLYGDPVLTEHLIDTAVHKSKYKSGYLSFSERA
DEISEDDKKRIMQEFEKVIFCGLEPDQYDILWVEHADKDIDDNNPVGRLELNFVIPCQELRTGKSFQPYY
EPADQRRVNAWKNIINAEVKTINAERLSDPNDPKRQRLVNPYNSHAPRPSPFNINSYSKKQSDEDDEIIQ
HPKSRRDLEEALKRRLLLESQRGVVINRQSLLTTLRRWGLNVNRSNSETSVSVKHDDLKDKNGRVMSVRL
TGGMFAKNYRGIEFKPYIQEVNSNNYYSEPNKTHRSQLDKMNLEEGIKIKAQYHQDRYKEATLPEPLAIQ
KAKVTNIVEEAVDPKGAEQLKYNTPGKLDQKIVANKIE

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(12-225)


  Protein structure


Source ID Structure
AlphaFold DB N1NUY4

  Reference


[1] Petrova M et al. (2014) Genetic structure and biological properties of the first ancient multiresistance plasmid pKLH80 isolated from a permafrost bacterium. Microbiology. 160(Pt 10):2253-63. [PMID:25063046]


Auxiliary protein

ID   82 GenBank   CCW43459
Name   MobC_pKLH80 insolico UniProt ID   A0A0J9X2N9
Length   121 a.a. PDB ID   _
Note   _

  Auxiliary protein sequence


Download         Length: 121 a.a.        Molecular weight: 13876.86 Da        Isoelectric Point: 10.7339

>CCW43459.1 putative mobilisation protein, MobC (plasmid) [Psychrobacter maritimus]
MSKNSPINLDKRAKRNREISIRVNDYELLELKKRNRGSTVASWLRDIALGVTPVKPVDPELVRQLGRIGS
NLNQLTRHVNTERQVDAQVLYEIKAIREQIHLLIESSIQASKKSARENHDS

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(62-105)


  Protein structure


Source ID Structure
AlphaFold DB A0A0J9X2N9

  Reference


[1] Petrova M et al. (2014) Genetic structure and biological properties of the first ancient multiresistance plasmid pKLH80 isolated from a permafrost bacterium. Microbiology. 160(Pt 10):2253-63. [PMID:25063046]


Host bacterium

ID   51 GenBank   HF953351
Plasmid name   pKLH80 Incompatibility group   IncP1
Plasmid size   14835 bp Coordinate of oriT [Strand]   1..117 [-]
Host baterium   Psychrobacter maritimus

Cargo genes

Drug resistance gene   genes encoding resistance to streptomycin and tetracycline; carbenicillin-hydrolysing beta-lactamase gene: blaRTG-6
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -