Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100026
Name   oriT_pK214 in_silico
Organism   Lactococcus lactis subsp. lactis K214
Sequence Completeness      incomplete
NCBI accession of oriT (coordinates [strand])   NC_009751 (_)
oriT length   10 nt
IRs (inverted repeats)     _
Location of nic site      7..8
Conserved sequence flanking the
  nic site  
 
 TAGTGTG|TTA
Note   from GenBank

  oriT sequence  


Download         Length: 10 nt

>oriT_pK214
TAGTGTGTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Hickey RM et al. (2001) Exploitation of plasmid pMRC01 to direct transfer of mobilizable plasmids into commercial lactococcal starter strains. Appl Environ Microbiol. 67(6):2853-8. [PMID:11375207]


Relaxase


ID   25 GenBank   CAA63521
Name   Mob_pK214 insolico UniProt ID   O32791
Length   403 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 403 a.a.        Molecular weight: 46815.76 Da        Isoelectric Point: 9.2672

>CAA63521.1 mobilization protein (plasmid) [Lactococcus lactis subsp. lactis K214]
MSFAVARMQKVKSGNLVGVGNHNQRNTDNHSNKDIDVERSHLNYDLVNRTENYKRDIEQFINDNKSSSRA
VRKDAVLINEWIITSDNPFFKDKDDKEIKDFFDTAKSYFADKFGDNNIRYAQVHLDETTPHMHLGIVPFN
DEHKLSAKTVFNRQALQAVQDELPKYLNERGFELERGEKGSERKNLTVPEYKKAKDELKEITTTLEQRKS
EVLALSNDKAPTIKKESLDLKDETKTVKVPSGETIGIGKLRHEFMKNEERKTGNVIIPESKLNAVIKSYE
ELYKANEKLKNYAETDLPKEITRVKEKYRELAKDYNRLVRKSNQNIETLEELEKENKSLKNEIKGIYKGF
NQFMENTLGATVGQAKKLMNNLMSEVKEFVKGGEFEKIHRNETKTRDRDELSR

  Protein domains


Predicted by InterproScan.

(1-193)


  Protein structure


Source ID Structure
AlphaFold DB O32791

  Reference


[1] Hickey RM et al. (2001) Exploitation of plasmid pMRC01 to direct transfer of mobilizable plasmids into commercial lactococcal starter strains. Appl Environ Microbiol. 67(6):2853-8. [PMID:11375207]
[2] Perreten V et al. (1997) Antibiotic resistance spread in food. Nature. 389(6653):801-2. [PMID:9349809]


Host bacterium


ID   25 GenBank   NC_009751
Plasmid name   pK214 Incompatibility group   _
Plasmid size   29871 bp Coordinate of oriT [Strand]   7087..7098 [+]
Host baterium   Lactococcus lactis subsp. lactis K214

Cargo genes


Drug resistance gene   resistance to tetracyline, chloramphenicol, and streptomycin
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -