Detailed information of auxiliary protein

Auxiliary protein


ID   73 GenBank   AAR31102
Name   TraK_pJP4 insolico UniProt ID   Q6UP35
Length   132 a.a. PDB ID   _
Note   oriT binding protein

  Protein sequence


Download         Length: 132 a.a.        Molecular weight: 14621.83 Da        Isoelectric Point: 9.9884

>AAR31102.1 oriT binding protein (plasmid) [Cupriavidus pinatubonensis JMP134]
MPKTYPEELAEWVKGREAKKPRQDKHVVAFLAVKSDVQAALDAGYAMKTIWEHMKETGRLRCRYETFTQH
VKRYIKAAPVASPPPPATPPDSQPKGAKPEPKAAPPASESKSEPPKIGGFTFDATPKKEDLL

  Protein domains


Predicted by InterproScan

(7-74)

  Protein structure


Source ID Structure
AlphaFold DB Q6UP35

  Reference


[1] Trefault N et al. (2004) Genetic organization of the catabolic plasmid pJP4 from Ralstonia eutropha JMP134 (pJP4) reveals mechanisms of adaptation to chloroaromatic pollutants and evolution of specialized chloroaromatic degradation pathways. Environ Microbiol. 6(7):655-68. [PMID:15186344]