Detailed information of auxiliary protein

Auxiliary protein


ID   72 GenBank   AAR31101
Name   TraK_pJP4 insolico UniProt ID   Q6UP36
Length   105 a.a. PDB ID   _
Note   conjugal transfer relaxosome component TraJ

  Protein sequence


Download         Length: 105 a.a.        Molecular weight: 11812.61 Da        Isoelectric Point: 5.8882

>AAR31101.1 oriT binding protein (plasmid) [Cupriavidus pinatubonensis JMP134]
MFPEEKDEIEANAKRAGVSVARYLRDVGQGYQIKGVMDYQHVRELVRVNGDLGRLGGLLKLWLTDDVRTL
QFGEATILALLGRIEATQDEMSRIMKAVVQPRAEP

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB Q6UP36

  Reference


[1] Trefault N et al. (2004) Genetic organization of the catabolic plasmid pJP4 from Ralstonia eutropha JMP134 (pJP4) reveals mechanisms of adaptation to chloroaromatic pollutants and evolution of specialized chloroaromatic degradation pathways. Environ Microbiol. 6(7):655-68. [PMID:15186344]