Detailed information of auxiliary protein

Auxiliary protein

• ID: 68
• GenBank: CAJ15633
• Name: TraK_pTP6
• UniProt ID: Q7AS79
• Length: 132 a.a.
• PDB ID: _
• Note: _

Protein sequence

• Length: 132 a.a.
• Molecular weight: 14621.83 Da
• Isoelectric Point: 9.9884

>CAJ15633.1 TraK protein (plasmid) [uncultured bacterium]
MPKTYPEELAEWVKGREAKKPRQDKHVVAFLAVKSDVQAALDAGYAMKTIWEHMKETGRLRCRYETFTQH
VKRYIKAAPVASPPPPATPPDSQPKGAKPEPKAAPPASESKSEPPKIGGFTFDATPKKEDLL

Protein domains

Predicted by InterproScan

• Family of unknown function (DUF5338) (DUF5338) (7-74)

Protein structure

• AlphaFold DB: Q7AS79