Detailed information of auxiliary protein

Auxiliary protein

• ID: 664
• GenBank: WP_001291056
• Name: WP_001291056_FWSEC0142|unnamed2
• UniProt ID: A0A4P8CE48
• Length: 110 a.a.
• PDB ID: _
• Note: Predicted by oriTfinder 2.0

Protein sequence

• Length: 110 a.a.
• Molecular weight: 12597.68 Da
• Isoelectric Point: 10.6096

>WP_001291056.1 MULTISPECIES: plasmid mobilization protein MobA [Enterobacteriaceae]
MSEKKTRSGSEKRQKNVLIAVRFSPEEAEIVKEKAEKNGLTVSTLIRKTVLGKQINARIDEDFLKELMRL
GRLQKHLFVEGKRTGDKEYAEVLVAITELANTLRRDLMGR

Protein domains

Predicted by InterproScan

• Family of unknown function (DUF6290) (DUF6290) (19-66)

Protein structure

• AlphaFold DB: A0A4P8CE48