Detailed information of auxiliary protein

Auxiliary protein

• ID: 65
• GenBank: YP_758723
• Name: TraK_pBS228
• UniProt ID: Q0E685
• Length: 134 a.a.
• PDB ID: _
• Note: TraK oriT binding protein

Protein sequence

• Length: 134 a.a.
• Molecular weight: 14716.82 Da
• Isoelectric Point: 10.5082

>YP_758723.1 TraK oriT binding protein (plasmid) [Pseudomonas aeruginosa]
MPKSYTDELAEWVESRAAKKRRRDEAAVAFLAVRADVEAALASGYALVTIWEHMRETGKVKFSYETFRSH
ARRHIKAKPADVPAPQAKAAEPAPAPKTPEPRRPKQGGKAEKPAPAAAPTGFTFNPTPDKKDLL

Protein domains

Predicted by InterproScan

• Family of unknown function (DUF5338) (DUF5338) (7-74)

Protein structure

• AlphaFold DB: Q0E685