Detailed information of auxiliary protein

Auxiliary protein

• ID: 62
• GenBank: AFJ38147
• Name: TraK_BRA100
• UniProt ID: I2ALH3
• Length: 132 a.a.
• PDB ID: _
• Note: binds oriT during conjugative plasmid transfer

Protein sequence

• Length: 132 a.a.
• Molecular weight: 14621.83 Da
• Isoelectric Point: 9.9884

>AFJ38147.1 protein TraK (plasmid) [Mycobacteroides abscessus subsp. bolletii F1725]
MPKTYPEELAEWVKGREAKKPRQDKHVVAFLAVKSDVQAALDAGYAMKTIWEHMKETGRLRCRYETFTQH
VKRYIKAAPVASPPPPATPPDSQPKGAKPEPKAAPPASESKSEPPKIGGFTFDATPKKEDLL

Protein domains

Predicted by InterproScan

• Family of unknown function (DUF5338) (DUF5338) (7-74)

Protein structure

• AlphaFold DB: I2ALH3