Detailed information of auxiliary protein

Auxiliary protein

• ID: 617
• GenBank: WP_136764583
• Name: WP_136764583_FWSEC0390|unnamed2
• UniProt ID: _
• Length: 110 a.a.
• PDB ID: _
• Note: Predicted by oriTfinder 2.0

Protein sequence

• Length: 110 a.a.
• Molecular weight: 12639.76 Da
• Isoelectric Point: 10.6096

>WP_136764583.1 plasmid mobilization protein MobA [Escherichia coli]
MSEKKTRSGSEKRQKNVLIAVRFSPEEAEIVKEKAEKNGLTVSTLIRKTVLVKQINARIDEDFLKELMRL
GRLQKHLFVEGKRTGDKEYAEVLVAITELANTLRRDLMGR

Protein domains

Predicted by InterproScan

• Family of unknown function (DUF6290) (DUF6290) (19-66)

Protein structure

No available structure.