Detailed information of auxiliary protein
Auxiliary protein
| ID | 6 | GenBank | CAJ85729 |
| Name | TraK_RK2  |
UniProt ID | A6H981 |
| Length | 134 a.a. | PDB ID | _ |
| Note | TraK oriT binding protein | ||
Protein sequence
Download Length: 134 a.a. Molecular weight: 14716.82 Da Isoelectric Point: 10.5082
>CAJ85729.1 TPA: TraK oriT binding protein (plasmid) [Birmingham IncP-alpha plasmid]
MPKSYTDELAEWVESRAAKKRRRDEAAVAFLAVRADVEAALASGYALVTIWEHMRETGKVKFSYETFRSH
ARRHIKAKPADVPAPQAKAAEPAPAPKTPEPRRPKQGGKAEKPAPAAAPTGFTFNPTPDKKDLL
MPKSYTDELAEWVESRAAKKRRRDEAAVAFLAVRADVEAALASGYALVTIWEHMRETGKVKFSYETFRSH
ARRHIKAKPADVPAPQAKAAEPAPAPKTPEPRRPKQGGKAEKPAPAAAPTGFTFNPTPDKKDLL
Protein domains
Predicted by InterproScan
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6H981 |
Reference
[1] Zatyka M et al. (1994) Location and nucleotide sequence of the transfer origin of the broad host range plasmid RK2. Microbiology. 140 ( Pt 11):2981-90. [PMID:7812437]
[2] Waters VL et al. (1991) Sequence identity in the nick regions of IncP plasmid transfer origins and T-DNA borders of Agrobacterium Ti plasmids. Proc Natl Acad Sci U S A. 88(4):1456-60. [PMID:1996345]