Detailed information of auxiliary protein

Auxiliary protein


ID   59 GenBank   CAG30904
Name   TraK_pTB11 insolico UniProt ID   Q5ZHD7
Length   134 a.a. PDB ID   _
Note   involved in conjugative DNA transfer

  Protein sequence


Download         Length: 134 a.a.        Molecular weight: 14716.82 Da        Isoelectric Point: 10.5082

>CAG30904.1 oriT-binding protein TraK (plasmid) [uncultured bacterium]
MPKSYTDELAEWVESRAAKKRRRDEAAVAFLAVRADVEAALASGYALVTIWEHMRETGKVKFSYETFRSH
ARRHIKAKPADVPAPQAKAAEPAPAPKTPEPRRPKQGGKAEKPAPAAAPTGFTFNPTPDKKDLL

  Protein domains


Predicted by InterproScan

(7-74)

  Protein structure


Source ID Structure
AlphaFold DB Q5ZHD7

  Reference


[1] Tennstedt T et al. (2005) Sequence of the 68,869 bp IncP-1alpha plasmid pTB11 from a waste-water treatment plant reveals a highly conserved backbone, a Tn402-like integron and other transposable elements. Plasmid. 53(3):218-38. [PMID:15848226]