Detailed information of auxiliary protein

Auxiliary protein


ID   58 GenBank   CAG30903
Name   TraK_pTB11 insolico UniProt ID   Q5ZHD8
Length   123 a.a. PDB ID   _
Note   oriT-binding protein

  Protein sequence


Download         Length: 123 a.a.        Molecular weight: 13463.65 Da        Isoelectric Point: 7.9867

>CAG30903.1 oriT-binding protein (plasmid) [uncultured bacterium]
MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAVGQGYKITGVVDYEHVRELARINGDL
GRLGGLLKLWLTDDPRTARFGDATILALLAKIEEKQDELGKVMMGVVRPRAEP

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB Q5ZHD8

  Reference


[1] Tennstedt T et al. (2005) Sequence of the 68,869 bp IncP-1alpha plasmid pTB11 from a waste-water treatment plant reveals a highly conserved backbone, a Tn402-like integron and other transposable elements. Plasmid. 53(3):218-38. [PMID:15848226]