Detailed information of auxiliary protein

Auxiliary protein


ID   57 GenBank   CAG30902
Name   TraK_pTB11 insolico UniProt ID   Q5ZHD9
Length   119 a.a. PDB ID   _
Note   involved in conjugative DNA transfer; relaxosome stabilisation

  Protein sequence


Download         Length: 119 a.a.        Molecular weight: 12869.28 Da        Isoelectric Point: 4.1047

>CAG30902.1 TraH protein (plasmid) [uncultured bacterium]
MSNPNEMTDEEIAAAMEAFDLPQPEPPSTPQAATATDGTLAPSAPAEPSHSASPTLDALDESRRPKAKTV
CERCPNSVWFASPAELKCYCRVMFLVTWSSKEPNQLTHCDGEFLGQEEG

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB Q5ZHD9

  Reference


[1] Tennstedt T et al. (2005) Sequence of the 68,869 bp IncP-1alpha plasmid pTB11 from a waste-water treatment plant reveals a highly conserved backbone, a Tn402-like integron and other transposable elements. Plasmid. 53(3):218-38. [PMID:15848226]