Detailed information of auxiliary protein

Auxiliary protein


ID   48 GenBank   ACQ42156
Name   NikA_pEK204 insolico UniProt ID   C7SA35
Length   110 a.a. PDB ID   _
Note   plasmid mobilization protein

  Protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>ACQ42156.1 plasmid mobilization protein (plasmid) [Escherichia coli]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB C7SA35

  Reference


[1] Woodford N et al. (2009) Complete nucleotide sequences of plasmids pEK204, pEK499, and pEK516, encoding CTX-M enzymes in three major Escherichia coli lineages from the United Kingdom, all belonging to the international O25:H4-ST131 clone. Antimicrob Agents Chemother. 53(10):4472-82. [PMID:19687243]