Detailed information of auxiliary protein

Auxiliary protein

• ID: 47
• GenBank: NP_061452
• Name: TraY_F
• UniProt ID: P06627
• Length: 131 a.a.
• PDB ID: _
• Note: The auxiliary protein TraY_F has two binding sites on F plasmid: binding to oriT_F promote nicking activity of the relaxase TraI_F prior to conjugative transfer binding to Py promoter to up-regulate tra gene expression [PMID:10391902].

Protein sequence

• Length: 131 a.a.
• Molecular weight: 15183.38 Da
• Isoelectric Point: 9.9240

>NP_061452.1 traY (plasmid) [Escherichia coli K-12]
MKRFGTRSATGKMVKLKLPVDVESLLIEASNRSGRSRSFEAVIRLKDHLHRYPKFNRAGNIYGKSLVKYL
TMRLDDETNQLLIAAKNRSGWCKTDEAADRVIDHLIKFPDFYNSEIFREADKEEDITFNTL

Protein domains

Predicted by InterproScan

• TraY domain (TraY) (70-117)

• TraY domain (TraY) (16-59)

Protein structure

• AlphaFold DB: P06627

Reference

[1] de la Cruz F et al. (2010) Conjugative DNA metabolism in Gram-negative bacteria. FEMS Microbiol Rev. 34(1):18-40. [PMID:19919603]
[2] Frost LS et al. (1994) Analysis of the sequence and gene products of the transfer region of the F sex factor. Microbiol Rev. 58(2):162-210. [PMID:7915817]