Detailed information of auxiliary protein
Auxiliary protein
ID | 46 | GenBank | NP_061450 |
Name | TraY_F | UniProt ID | P10026 |
Length | 127 a.a. | PDB ID | 2G7O, 2G9E, 4QPO, 4QPQ |
Note | _ |
Protein sequence
Download Length: 127 a.a. Molecular weight: 14507.44 Da Isoelectric Point: 5.0516
>NP_061450.1 traM (plasmid) [Escherichia coli K-12]
MAKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNSKFEYANMVEDIREKVSSEMERFFPKNDDE
MAKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNSKFEYANMVEDIREKVSSEMERFFPKNDDE
Protein domains
Predicted by InterproScan
Protein structure
Source | ID | Structure |
---|---|---|
PDB | 2G7O | |
PDB | 2G9E | |
PDB | 4QPO | |
PDB | 4QPQ | |
AlphaFold DB | P10026 |
Reference
[1] de la Cruz F et al. (2010) Conjugative DNA metabolism in Gram-negative bacteria. FEMS Microbiol Rev. 34(1):18-40. [PMID:19919603]
[2] Frost LS et al. (1994) Analysis of the sequence and gene products of the transfer region of the F sex factor. Microbiol Rev. 58(2):162-210. [PMID:7915817]